<?xml version="1.0" encoding="UTF-8"?>
<rss version="2.0"
     xmlns:content="http://purl.org/rss/1.0/modules/content/"
     xmlns:dc="https://purl.org/dc/elements/1.1/"
     xmlns:dcterms="http://purl.org/dc/terms/"
     xmlns:media="http://search.yahoo.com/mrss/"
     xmlns:atom="http://www.w3.org/2005/Atom"
     xmlns:cf="https://www.futureplc.com/rss/content-flags"
>
    <channel>
                    <atom:link href="https://www.cinemablend.com/feeds/tag/bojack-horseman" rel="self" type="application/rss+xml" />
                            <title><![CDATA[ Latest from CinemaBlend in Bojack-horseman ]]></title>
                <link>https://www.cinemablend.com/tag/bojack-horseman</link>
        <description><![CDATA[ All the latest bojack-horseman content from the CinemaBlend team ]]></description>
                                    <lastBuildDate>Tue, 02 Jun 2026 00:45:00 +0000</lastBuildDate>
                            <language>en</language>
                                <item>
                                                            <title><![CDATA[ TV Fans Are Debating The Most Depressing Show Ever, And Points Were Made ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/tv-fans-debating-most-depressing-show-ever-points-made</link>
                                                                            <description>
                            <![CDATA[ Do these shows make you depressed? ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">it5yQ2iGyErkSuWs7ZPUSU</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/PCza9wvDDv3LmtRcBJZTy8-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Tue, 02 Jun 2026 00:45:00 +0000</pubDate>                                                                                                                                                                                                                                <category><![CDATA[Television]]></category>
                                                                                                                    <dc:creator><![CDATA[ Liz Konkel ]]></dc:creator>                                                                                                        <dc:description><![CDATA[ null ]]></dc:description>
                                                                                                                                <cf:isSponsored>false</cf:isSponsored>
                <cf:hasAffiliateLinks>false</cf:hasAffiliateLinks>
                <cf:isPaid>false</cf:isPaid>
                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/PCza9wvDDv3LmtRcBJZTy8-1280-80.jpg">
                                                            <media:credit><![CDATA[Hulu]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[Elisabeth Moss as June walking in a line with other handmaids in a Handmaid&#039;s Tale.]]></media:description>                                                            <media:text><![CDATA[Elisabeth Moss as June walking in a line with other handmaids in a Handmaid&#039;s Tale.]]></media:text>
                                <media:title type="plain"><![CDATA[Elisabeth Moss as June walking in a line with other handmaids in a Handmaid&#039;s Tale.]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/PCza9wvDDv3LmtRcBJZTy8-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>Fans have long debated which show has been the saddest ever made. For some, like me, they run far away from tragic plots. Others are instantly hooked and enjoy a good cry. Now, that debate rages on and, via a recent thread of messages, many fans are throwing out the most obvious titles, with <em>Chernobyl</em> being one, while others are picking more niche shows, such as a David Tennant series. (And no, it’s not <em>Doctor Who</em>.) Regardless, fans are making good points. </p><p>While every Whovian knows <em>Who</em> has <a href="https://www.cinemablend.com/streaming-news/doctor-who-73-yards-best-of-season-tragic-moment-ruby-sunday">tragic moments that often feel cruel</a>, it’s David Tennant’s detective series, <em>Broadchurch</em>,<em> </em>that fans say is particularly sad. That was just one of the answers shared after fans were recently asked for their opinions on <a href="https://www.reddit.com/r/television/comments/1tt13r1/whats_the_most_depressing_goddam_show_youve_seen/?rdt=54267">Reddit</a>. TV devotees also listed <em>The Handmaid’s Tale</em>, <em>Black Mirror</em> and even their local news as the most depressing pieces of content they’ve ever seen. All in all, the fans didn't disappoint with their answers, some of which can be seen below:</p><ul><li><strong>cancelthis2077</strong>: Black Mirror (well the early seasons).</li><li><strong>pugilist12</strong>: Oz is a safe bet for most depressing show I’ve seen. I don’t think a single genuinely good thing happens to anyone the entire run, and the majority of what does happen is horrific.</li><li><strong>Maddie-Moo</strong>: I just started watching The Pacific for the first time and that is a 60-minute depression sesh.</li><li><strong>LaosLegend</strong>: Bojack Horseman was pretty depressing to me.</li><li><strong>Softrockstarr</strong>: Broadchurch is up there.</li><li><strong>No_Tamanegi</strong>: Dark. The more you realize about what's happening, the worse it gets.</li></ul><p><em>Black Mirror</em>, in particular, is called out in the thread multiple times. Honestly, fans aren’t wrong for including the Netflix series, which is known for having dark twists, like in the episode "Hotel Reverie". This episode has one of the most <a href="https://www.cinemablend.com/streaming-news/hotel-reverie-one-of-black-mirror-haunting-heartbreaking-ending-i-have-to-talk-about-it">haunting and heartbreaking endings</a> in the anthology franchise's history. For those who enjoy dark shows, they can enjoy this series and more with a <a href="https://www.cinemablend.com/streaming-news/netflix-subscription-the-plans-the-price-and-whats-included">Netflix subscription</a> who enjoy dark shows should probably check out the series, but it may not be for those who prefer brighter fare. </p><p>Elsewhere, several other users find shows based on real events more depressing. For this reason, many listed <em>Chernobyl</em>. Admittedly, I have not seen the show, but I'm aware of the historical context, and therefore have stayed away. The most upsetting part of the series is “the standalone dog episode,” according to KTOWNTHROWAWAY9001. This episode apparently left a lasting impression on fans, such as TheArtfulLlama, who said: </p><div><blockquote><p>It literally ruined my weekend when I watched it. </p></blockquote></div><p>There are some fans who've bowed out after just watching the pilot of a show, which I can understand. I went into <em>A Million Little Things </em>with high hopes as it had David Giuntoli, James Roday Rodriguez and Grace Park. I’m a fan of each of those actors but, because the pilot was so depressing for me, I never made it further. </p><p>Similar feelings are true for user CrissBliss, as they had bow out of <em>Handmaid’s Tale</em>, saying, “I had to stop watching because every week was just one depressing thing after the next.” The Bruce Miller-created show portrays a horrific future that some feel hits a little too close to home. However, the franchise has thrived and continues with the <a href="https://www.cinemablend.com/streaming-news/critics-seen-the-testaments-can-chase-infiniti-carry-handmaids-tale-spinoff">well received spin-off, <em>The Testaments</em></a>. </p><p>Other titles mentioned include <em>Mr. Robot</em> with Rami Malek, <em>Skins</em>, <em>Six Feet Under</em>, <em>Shameless</em> and <em>The Wire</em>. Although these are series that have seemingly scarred fans in one way or another, some of these are also <a href="https://www.cinemablend.com/television/fans-reminiscing-tv-shows-hooked-immediately-ill-co-sign-most-popular-answer-chernobyl">shows that have immediately hooked viewers</a>, and some are considered to be amongst the best shows of all time. So, while these titles and others may be downers, it's hard to deny their cultural impact.</p><p>Anyone who's seeking out darker shows should look over the <a href="https://www.cinemablend.com/television/2026-tv-premiere-date-schedule-network-streaming-series">2026 TV schedule</a> to see what's coming up throughout the rest of the year.</p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ 32 Fake TV Shows That Are Just As Fun As The Real Series They Appear In ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/fake-tv-shows-just-as-fun-as-real-series-they-appear-in</link>
                                                                            <description>
                            <![CDATA[ Nothing like a good show-within-a-show. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">ZNoK8Tip2zkT8WzAC5oMBa</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/75zXyEkDytpKhC7oRkcnQ7-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Sun, 21 Sep 2025 17:32:00 +0000</pubDate>                                                                                                                                                                                                                                <category><![CDATA[Television]]></category>
                                                                                                                    <dc:creator><![CDATA[ Nick Venable ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/TzeQjfZT5cKqHRsEqudtqT.png ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Nick Venable is an Assistant Managing Editor, and the TV Editor. His humble origin story with CinemaBlend began all the way back in the pre-streaming era, circa 2009, as a freelancing DVD reviewer and TV recapper. After rising up through the ranks covering Movies, Nick leapfrogged over to the small screen to cover more and more television news and interviews, eventually taking over the section for the current era. Born in Louisiana and currently living in Texas — Who Dat Nation over America’s Team all day, all night — Nick spent several years in the hospitality industry, and also worked as a 911 operator. And if you ever happened to hear his music or read his comics/short stories, you have his sympathy. His love for his wife and daughters is almost equaled by his love of gasp-for-breath laughter and gasp-for-breath horror. A lifetime spent in the vicinity of a television screen led to his current dream job, as well as his knowledge of too many TV themes and ad jingles.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What He&#039;s Into&lt;/strong&gt;: Nick is one of those people who won’t necessarily insert a Monty Python reference into every conversation, but is still mentally equipped to do so. Beyond such appreciation for surreal UK comedy, Nick also indulges in as much horror splendor as possible, from Stephen King novels to James Tynion IV comics to Freddy Krueger one-liners to all things Mike Flanagan. Throw in a dash of NFL, some 311 and Weird Al, fried crawfish poboys, bourbon, ‘90s-era pro wrestling, crossword puzzles and mystery-driven video games, and baby, you got a stew going. (Nick will insert an Arrested Development reference into every conversation, if possible.)&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What He&#039;s Excited About&lt;/strong&gt;: Anything Jeff Lemire, Tom King and W. Maxwell Prince think of, ever. More of Kelly Reilly’s deliriously fierce performances on Yellowstone. HBO’s The Last of Us. Clone High’s return. Colin Farrell’s Penguin being in every movie/TV show/breakfast cereal.&lt;/p&gt; ]]></dc:description>
                                                                                                                                <cf:isSponsored>false</cf:isSponsored>
                <cf:hasAffiliateLinks>false</cf:hasAffiliateLinks>
                <cf:isPaid>false</cf:isPaid>
                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/75zXyEkDytpKhC7oRkcnQ7-1280-80.jpg">
                                                            <media:credit><![CDATA[Hulu/ABC]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[Tim Allen and Richard Karn in Home Improvement.]]></media:description>                                                            <media:text><![CDATA[Tim Allen and Richard Karn in Home Improvement.]]></media:text>
                                <media:title type="plain"><![CDATA[Tim Allen and Richard Karn in Home Improvement.]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/75zXyEkDytpKhC7oRkcnQ7-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>TV characters may often lead more exciting lives than the average person, but they're just as susceptible as anyone to relaxing on the couch while watching their own televisions. Most of the time, those shows-within-shows are completely fictional, as not to cause any copyright friction, which can lead to some hilariously weird and inspired creations. </p><p>So, in the vein of <a href="https://www.cinemablend.com/movies/fictional-bands-we-really-want-to-see-in-concert">fake bands we love listening to</a>, <a href="https://www.cinemablend.com/movies/fake-brands-in-movies-and-tv-shows-like-sweetums-and-allied-biscuit">fictional brandings we love promoting</a>, and <a href="https://www.cinemablend.com/movies/intriguing-fake-commercials-from-movies-tv-shows">commercials for faux products</a>, let's now celebrate fake TV shows that might just be as watchable as the real ones. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="kCCuwuBEuPJnRSmcJmuLqn" name="married with children al" alt="Al Bundy holding a beer in Married with Children" src="https://cdn.mos.cms.futurecdn.net/kCCuwuBEuPJnRSmcJmuLqn.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Disney+)</span></figcaption></figure><h2 id="married-with-children-psycho-dad">Married...With Children - "Psycho Dad"</h2><p>Perhaps Al Bundy's favorite TV show, the "simple saga of a guy run amok in the Old West" was somehow a PBS series (and then a Fox one), despite being one of the most violent shows on TV, which the theme song alludes to. Didn't stop the spinoff <em>Psycho Mom</em> from happening, though.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:57.03%;"><img id="b8hDs2Kmrjh2wr9CDAmtU9" name="duck-tective" alt="Duck-Tective terrified quack in Gravity Falls" src="https://cdn.mos.cms.futurecdn.net/b8hDs2Kmrjh2wr9CDAmtU9.jpg" mos="" align="middle" fullscreen="" width="1280" height="730" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Disney Channel)</span></figcaption></figure><h2 id="gravity-falls-duck-tective">Gravity Falls - "Duck-tective"</h2><p>If it walks like a duck and solves mysteries like a detective, it can only be <em>Gravity Falls</em>' fine-feathered sleuth Duck-tective, who heads up the titular mystery series that relies heavily on bad puns and cheap effects, like so many shows of the '80s and '90s.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="mUBBPwpFUyeHfHRnjJDJmn" name="inspector spacetime" alt="Inspector Spacetime in Community" src="https://cdn.mos.cms.futurecdn.net/mUBBPwpFUyeHfHRnjJDJmn.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Disney+)</span></figcaption></figure><h2 id="community-inspector-spacetime">Community - "Inspector Spacetime"</h2><p>Despite <em>Community</em>'s Abed having once worn a <em>Doctor Who</em> T-shirt, his preferred sci-fi time-travel saga is <em>Inspector Spacetime</em>, a very on-the-nose homage to the long-running UK fave. (The American version introduced years later was portrayed by Luke Perry.) I'd wager <em>I.S.</em> has more canonical backstory than almost any other show-within-a-show, with lots of background for fans, real and otherwise, to dig into.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="eieZeTUTKc5Do6zcL6xG6Y" name="terrance and philip" alt="Terrance and Phillip on South Park" src="https://cdn.mos.cms.futurecdn.net/eieZeTUTKc5Do6zcL6xG6Y.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Paramount+)</span></figcaption></figure><h2 id="south-park-the-terrance-and-phillip-show">South Park - "The Terrance And Phillip Show"</h2><p>Two of the biggest celebrities within <em>South Park</em> that aren't parodies of real-world celebs are Sir Phillip Niles Argyle and Sir Terrance Henry Stoot, best known to the Canadian comedy lovers as Terrance and Phillip, who have their own TV show that's a real gas...gas...gasssss. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="r6KAdBd6AcWZUkBsm4eK6Y" name="when the whistle blows" alt="When the Whistle Blows in Extras" src="https://cdn.mos.cms.futurecdn.net/r6KAdBd6AcWZUkBsm4eK6Y.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: HBO Max)</span></figcaption></figure><h2 id="extras-when-the-whistle-blows">Extras - "When The Whistle Blows"</h2><p>One of the funniest things about Ricky Gervais satirizing BBC sitcoms in HBO's <em>Extras</em> is how little it feels like a parody, and how believable it would be as a real-world series with its lowest-common-denominator jokes, forever cementing "Are you 'avin' a laugh?" into the annals of love-to-hate TV catchphrases.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="hsS4wdeBhpED7QLv8Bo66Y" name="TV funhouse" alt="TV Funhouse logo on Saturday Night Live" src="https://cdn.mos.cms.futurecdn.net/hsS4wdeBhpED7QLv8Bo66Y.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Peacock)</span></figcaption></figure><h2 id="saturday-night-live-tv-funhouse">Saturday Night Live - "TV Funhouse"</h2><p><em>Saturday Night Live</em> has featured loads of <a href="https://www.cinemablend.com/television/snl-funniest-fake-movie-trailers">fake movie trailers</a>, songs, TV shows, etc., but perhaps the only applicable recurring sketch to get spun off with its own shows-within-a-show concept was "TV Funhouse," as created by Robert Smigel. Later a standalone series on Comedy Central, the OG run gave the world the Ambiguously Gay Duo, "Bambi 2002," and other <em>SNL</em> classics from the '90s and 2000s.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="rU7crL3qZXEyYDc3qu4r6Y" name="professor proton" alt="Professor Proton show on Young Sheldon" src="https://cdn.mos.cms.futurecdn.net/rU7crL3qZXEyYDc3qu4r6Y.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Paramount+)</span></figcaption></figure><h2 id="the-big-bang-theory-professor-proton">The Big Bang Theory - "Professor Proton"</h2><p>I'd have to imagine <em>Big Bang Theory</em>'s Sheldon Cooper would have loved <em>Mr. Wizard's World</em> or <em>Beakman's World</em> if he were real, as his favorite small-screen personality was the science educator Professor Proton (real name: Arthur Jeffries). For viewers, Proton's excellence was naturally due to <a href="https://www.cinemablend.com/television/2560539/how-the-big-bang-theory-landed-bob-newhart-as-professor-proton">comedy legend Bob Newhart being cast</a>. And you can't forget his puppet pal Gino the Neutrino, even if it's best not to bring up the puppeteer. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="eL4aooNPomgdasYnLb4ssn" name="johnny karate" alt="Johnny Karate's final episode in Parks and Recreation" src="https://cdn.mos.cms.futurecdn.net/eL4aooNPomgdasYnLb4ssn.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Disney+)</span></figcaption></figure><h2 id="parks-and-recreation-the-johnny-karate-super-awesome-musical-explosion-show">Parks And Recreation - "The Johnny Karate Super Awesome Musical Explosion Show"</h2><p>Chris Pratt's Andy Dwyer brought Johnny Karate to life initially as a guitar-playing act for children's birthday parties, but that just wasn't musical or explosive enough, so of course he got his own inspirational TV show. Johnny may have been a doofus, but alter-alter ego Jonathan Karate is the one who has it all together. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1866px;"><p class="vanilla-image-block" style="padding-top:58.84%;"><img id="75pK9VyGCexLjdF9jCkN8Y" name="the fatheads" alt="The Fatheads intro in Rocko's Modern Life" src="https://cdn.mos.cms.futurecdn.net/75pK9VyGCexLjdF9jCkN8Y.jpg" mos="" align="middle" fullscreen="" width="1866" height="1098" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Paramount+)</span></figcaption></figure><h2 id="rocko-s-modern-life-meet-the-fatheads">Rocko's Modern LIfe - "Meet The Fatheads"</h2><p>Within <em>Rocko's Modern Life</em>, the Bigheads' lives were fictionalized as <em>The Fatheads</em>, a family sitcom centered on pretty awful and stereotypical characters. Amusingly enough, the revival special <em>Static Cling</em> also featured the in-universe revival of <em>The Fatheads</em>, which not everyone was a fan of. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="MFqH8HNLjrGL6jNpWtibP3" name="home improvement.jpg" alt="Tim, Al and Lisa on Tool Time in Home Improvement" src="https://cdn.mos.cms.futurecdn.net/MFqH8HNLjrGL6jNpWtibP3.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Hulu)</span></figcaption></figure><h2 id="home-improvement-tool-time">Home Improvement - "Tool Time"</h2><p>One of TV's ultimate "How-Not-To" characters, Tim "The Tool Man" Taylor somehow kept his job hosting the Detroit-set series "Tool Time," despite being shockingly consistent at destroying property and electrical equipment with ease. It's just as shocking that co-host Al Borland didn't quit or suffer grave injuries during that run.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="odnBp5kgH3ZWF86JPwMH6Y" name="only murders" alt="Charles in hat in disbelief in Only Murders in the Building" src="https://cdn.mos.cms.futurecdn.net/odnBp5kgH3ZWF86JPwMH6Y.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Disney+)</span></figcaption></figure><h2 id="only-murders-in-the-building-brazzos">Only Murders In The Building - "Brazzos"</h2><p>No one remembers the detective series "Brazzos" as well as <em>Only Murders in the Building</em>'s Charles-Haden Savage, the actor who donned the iconic hat for its surprisingly long run. (Okay, perhaps his loyal stunt double Sazz remembered it just as fondly.) But who else could have spun these banal words into an oft-ish-repeated catchphrase: "This sends the investigation into a whole new direction." So many new directions for this guy. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="rMG6BEigx3EHC93AUq4A6Y" name="oodles" alt="Oodles the Talking Poodle in Rugrats" src="https://cdn.mos.cms.futurecdn.net/rMG6BEigx3EHC93AUq4A6Y.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Paramount+)</span></figcaption></figure><h2 id="rugrats-oodles-the-talking-poodle">Rugrats - "Oodles The Talking Poodle"</h2><p>As an avid <em>Rugrats</em> fan during the NickToons era, it's been 30+ years since I've been able to hear the world "poodle" without hearing a light "ding" behind it, as it goes in the talking dog's theme song. "OOdles. OOdles the TALking POOdle. Ding." How is this <em>not</em> a movie by now?</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="pQfVSeqpMZz7z4K3DxLB6Y" name="wormhole x-treme" alt="Wormhole X-Treme title screen on Stargate SG-1" src="https://cdn.mos.cms.futurecdn.net/pQfVSeqpMZz7z4K3DxLB6Y.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Pluto TV)</span></figcaption></figure><h2 id="stargate-sg-1-wormhole-x-treme">Stargate SG-1 - "Wormhole X-Treme"</h2><p>While <em>Stargate SG-1</em> didn't always show off its funny bone so directly, the self-spoofing 100th episode "Wormhole X-Treme," which focuses on the action-geared sci-fi series that provided the ep's title. I wish every show I love had a parody as faithful and fan-friendly as this one.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="t4EdnsBbeJGJ5h6oxdBbjn" name="krusty the clown" alt="Krusty the Clown close-up on The Simpsons" src="https://cdn.mos.cms.futurecdn.net/t4EdnsBbeJGJ5h6oxdBbjn.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Disney+)</span></figcaption></figure><h2 id="the-simpsons-the-krusty-the-clown-show">The Simpsons - "The Krusty The Clown Show"</h2><p>If not for Krusty the Clown's quality-questionable variety show, Bart, Lisa and <em>Simpsons</em> fans around the world might never have been introduced to the hyperviolent  "Itchy and Scratchy Show," which superceded its own source clown's popularity, with former sidekick Sideshow Bob amassing more notoriety. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="FXFRvkDvVQCtLk5XDg4HUj" name="murderbot the rise and fall of sanctuary moon" alt="Captain and Lieutenant from Sanctuary Moon in Murderbot Season 1" src="https://cdn.mos.cms.futurecdn.net/FXFRvkDvVQCtLk5XDg4HUj.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Apple TV+)</span></figcaption></figure><h2 id="murderbot-the-rise-and-fall-of-sanctuary-moon">Murderbot - "The Rise and Fall of Sanctuary Moon"</h2><p>It's easy to see why Alexander Skarsgård's sentient SecUnit just wants to spend all day, all 397 (at least) episodes of the sudsy space opera "The Rise and Fall of Sanctuary Moon." With legit talents like John Cho,  Clark Gregg and DeWanda Wise heading up the <em>How to Get Away with Murder</em>-esque series, this is easily worthy of a standalone spinoff to keep viewers rapt. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="5GKMsBx2URJBjwrGozkEU9" name="hello megan" alt="Hello Megan opening in Young Justice" src="https://cdn.mos.cms.futurecdn.net/5GKMsBx2URJBjwrGozkEU9.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Cartoon Network)</span></figcaption></figure><h2 id="young-justice-hello-megan">Young Justice - "Hello, Megan!"</h2><p>Who knew superheroes would get into such normalcy as the sitcom "Hello, Megan!" A by-the-books sitcom from 1979-1980, the show follows a pretty cheerleader, her BFF, hunky boyfriend, and parents, and not even for large-scale adventures, but just everyday plots like taking care of the school frog. Okay, fine, I completely understand why everyone is obsessed. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="YdB7n68AXuHzsxMoQNGYT9" name="candle cove" alt="Percy the Pirate in Channel Zero: Candle Cove" src="https://cdn.mos.cms.futurecdn.net/YdB7n68AXuHzsxMoQNGYT9.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Syfy)</span></figcaption></figure><h2 id="channel-zero-candle-cove">Channel Zero - "Candle Cove"</h2><p>The worst kind of TV show, I think we can all agree, is one that inevitably brings you harm just by watching it. So it goes for the first season of the <a href="https://www.cinemablend.com/television/great-horror-anthology-tv-shows-and-how-to-watch-them">excellent horror anthology</a> <em>Channel Zero</em>, where "Candle Cove" is a pirate-based puppet show that may only exist in the minds of its viewers. Watch out for The Skin-Taker, that's all I'm saying.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="WUNriFoQB23CZ4gMK6ZoU9" name="crying breakfast friends" alt="Steven Universe watching Crying Breakfast Friends" src="https://cdn.mos.cms.futurecdn.net/WUNriFoQB23CZ4gMK6ZoU9.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Cartoon Network)</span></figcaption></figure><h2 id="steven-universe-crying-breakfast-friends">Steven Universe - Crying Breakfast Friends</h2><p>If you don't know the value of watching "Crying Breakfast Friends," then I don't suggest mentioning it to Steven Universe's titular crystal being. He adores watching the various food items, leaking both tears of joy and tears of sorrow. Glum Glass and Weeping Egg Cup are all of us, really. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="WwENyBQzJNxoHJaPTx8rV9" name="ghostfacers" alt="Ghostfacers title screen in Supernatural" src="https://cdn.mos.cms.futurecdn.net/WwENyBQzJNxoHJaPTx8rV9.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="supernatural-ghostfacers">Supernatural - "Ghostfacers"</h2><p><em>Supernatural</em>, a show that legitimately crossed over with the animated <em>Scooby-Doo</em> gang, brought an equally silly spin to the never-ending number of paranormal investigator series that took over cable in the 21st century. Founded by the Ghostbusters-homaging Harry Spangler and Ed Zeddmore, the Ghostfacers appeared quite a few times over the years, and even sparked a web series of shorts.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="993TsLRvsRvhFZe5UnWTc9" name="horsin around" alt="BoJack and fake family in opening to Horsin' Around" src="https://cdn.mos.cms.futurecdn.net/993TsLRvsRvhFZe5UnWTc9.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="bojack-horseman-horsin-around">BoJack Horseman - "Horsin' Around"</h2><p>For as dramatically serious and maudlin as <em>BoJack Horseman</em> could get, none of that was to be found in the cornball hijinks of the in-series sitcom "Horsin' Around," centering on three kids adopted by a horse, obviously. It fights right alongside fare like <em>Punky Brewster</em>, with a slew of wonderfully groan-worthy lines perhaps best exemplified by the pun "Now, that's a horse of a different...crueller."</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="esMqcTaepXPyhAeYUbEqkn" name="Invitation to Love" alt="invitation to love title screen in Twin Peaks" src="https://cdn.mos.cms.futurecdn.net/esMqcTaepXPyhAeYUbEqkn.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Paramount+)</span></figcaption></figure><h2 id="twin-peaks-invitation-to-love">Twin Peaks - "Invitation To Love"</h2><p>Oh, to explore around inside David Lynch's brain to see all of the things he might have been thinking about for the expertly crafted soap opera "Invitation to Love," which was a favorite amongst some of the characters inhabiting <em>Twin Peaks</em>' titular town. The fact that the storylines reference the characters' lives only makes it more interesting. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1418px;"><p class="vanilla-image-block" style="padding-top:63.89%;"><img id="QVi9GEAozsVZxUhisgkVsn" name="Jerry pilot" alt="TV Jerry and friends around table in Jerry pilot on Seinfeld" src="https://cdn.mos.cms.futurecdn.net/QVi9GEAozsVZxUhisgkVsn.jpg" mos="" align="middle" fullscreen="" width="1418" height="906" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="seinfeld-jerry">Seinfeld - "Jerry"</h2><p>While <em>Seinfeld</em>'s show-within-a-show "Jerry" really only existed as a pilot and not as a fully ordered network-aired series, given the actions of its characters, its ridiculous plot is enough to make it one of the more memorable faux TV series out there. Jerry gets into a car accident, and the other insurance-less driver has to become Jerry's butler, making "Because he's MY butler" one of the more logically accurate fake TV catchphrases. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="mUDvZNkW4VRfKeQ2CXmypn" name="jolly farm revue" alt="Jolly Farm Revue in Family Guy" src="https://cdn.mos.cms.futurecdn.net/mUDvZNkW4VRfKeQ2CXmypn.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Disney+)</span></figcaption></figure><h2 id="family-guy-jolly-farm-revue">Family Guy - "Jolly Farm Revue"</h2><p>With an aesthetic that mashed up the <em>Teletubbies</em> with other pastoral children's fare, <em>Family Guy</em>'s faux UK series "Jolly Farm Revue" became an obsession of Stewie's, as he believed its characters actually existed, only to find them to be less real than his teddy bear Rupert. I prefer the American remake with that li'l cutie Karina Smirnoff. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="8m9rkHj28CEhZ2Psm97Pmn" name="mock trial" alt="Judge Reinhold in Mock Trial with J. Reinhold on Arrested Development" src="https://cdn.mos.cms.futurecdn.net/8m9rkHj28CEhZ2Psm97Pmn.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="arrested-development-mock-trial-with-j-reinhold">Arrested Development - "Mock Trial With J. Reinhold"</h2><p><em>Arrested Development</em>'s melting pot of humor is well-exemplified by Michael Bluth having a legal case heard as part of a courtroom reality show fronted by Judge Reinhold (who definitely isn't a real judge), with a theme song sung live on-set by William Hung and a backing band. Should this have turned into an actual series? "I'm going to allow it," even if it pretty much rips on a gag from <em>Clerks: the Animated Series</em>. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="vUNTPV2Krz6kfwLDUBckFo" name="mermaid man and barnacle boy" alt="Mermaid man and Barnacle Boy on SpongeBob SquarePants" src="https://cdn.mos.cms.futurecdn.net/vUNTPV2Krz6kfwLDUBckFo.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Paramount+)</span></figcaption></figure><h2 id="spongebob-squarepants-mermaid-man-and-barnacle-boy">SpongeBob SquarePants - "Mermaid Man And Barnacle Boy"</h2><p>Not only was the superhero series "Mermaid Man and Barnacle Boy" a fun show-within-a-show for <em>SpongeBob SquarePants</em>' characters, but the titular characters were a treat outside of their televised exploits as well. For one, they were originally voiced by legends Ernest Bornine and Tim Conway, and later boasted '60s <em>Batman</em> icons Adam West and Burt Ward in the respective hero and sidekick roles at one point or another. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="NFFHGnn4qkzJzFHRC4nUtn" name="milf island" alt="Milf Island logo on 30 rock" src="https://cdn.mos.cms.futurecdn.net/NFFHGnn4qkzJzFHRC4nUtn.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Peacock)</span></figcaption></figure><h2 id="30-rock-milf-island">30 Rock - "MILF Island"</h2><p>A fake TV show that will likely exist before this sentence is finished, <em>30 Rock</em>'s reality TV-aping romance competition <em>MILF Island</em> was sold with the disturbing tagline "25 Super-Hot Moms, 50 Eighth Grade Boys, No Rules." Okay, maybe we should just keep this one hidden behind a locked door back in 2008.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="qSLqQH6y8ojwcd3h9J92Do" name="Lost Expose" alt="Mr. LaShade in Expose in Lost" src="https://cdn.mos.cms.futurecdn.net/qSLqQH6y8ojwcd3h9J92Do.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="lost-expose">Lost - "Exposé"</h2><p><em>Lost</em>'s storylines didn't just flash backwards, forwards and sideways. They also went internal for the show-within-a-show <em>Exposé</em>, a '70s-esque action-adventure series in which Kiele Sanchez's Nikki was guest-starring. (With Billy Dee Williams as the lead of the faux show.) We see just enough to make me want more, although that would never happen, as audiences' dislike of Nikki and Rodrigo Santoro's Paolo was strong enough to get them killed off during the same season in which they were introduced.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="zTCGzaiDrcfbXCmD34LD6Y" name="ottoman empire" alt="Ottoman Empire in DuckTales" src="https://cdn.mos.cms.futurecdn.net/zTCGzaiDrcfbXCmD34LD6Y.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Disney+)</span></figcaption></figure><h2 id="ducktales-ottoman-empire">DuckTales - "Ottoman Empire"</h2><p>A TV parody that is too close to the real thing to be entirely comedic, <em>DuckTales</em>' "Ottoman Empire" centers on two twin rooster brothers, Johnny and Randy, who design custom ottomans for customers.  It's like <em>Property Brothers</em> with a punnier title, and you know, roosters.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="LKKUPwkAPBjQPu2yQ9ysU9" name="drew and jerry" alt="Drew and Jerry TV show in Drake and Josh" src="https://cdn.mos.cms.futurecdn.net/LKKUPwkAPBjQPu2yQ9ysU9.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Disney)</span></figcaption></figure><h2 id="drake-and-josh-drew-and-jerry">Drake And Josh - "Drew And Jerry"</h2><p><em>Drake & Josh</em> entered sitcom doppelgänger territory in Season 2 when Drake Bell and Josh Peck's namesake characters took a friendly break from each other, only to befriend someone else with the exact same personality. By the end, the titular teens were buds again, while their "others" were somehow given their own TV show that looks exactly like <em>D&J</em>. Presumably with its own Season 2 doppelgänger plot.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="UHk7ym9agTHQ6k2cgDruU9" name="estrada or nada" alt="Erik Estrada in Estrada or Nada in My Name Is Earl" src="https://cdn.mos.cms.futurecdn.net/UHk7ym9agTHQ6k2cgDruU9.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Disney+)</span></figcaption></figure><h2 id="my-name-is-earl-estrada-or-nada">My Name Is Earl - "Estrada Or Nada"</h2><p>We're at a point where real-life game shows are about as ridiculous as anything fictional, but <em>My Name Is Earl</em>'s "Estrada or Nada" is still pretty special. Basically, anyone can challenge the <em>CHiPs</em> star to any imaginable challenge, from shooting basketballs to eating hot dogs to looking like Erik Estrada. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="fVPKPUvCRyFnxfkwng2gT9" name="hypnotoad" alt="Hypnotoad in Futurama" src="https://cdn.mos.cms.futurecdn.net/fVPKPUvCRyFnxfkwng2gT9.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Disney+)</span></figcaption></figure><h2 id="futurama-everybody-loves-hynotoad">Futurama - "Everybody Loves Hynotoad"</h2><p>I love Hypnotoad. You love Hypnotoad. Everybody loves Hypnotoad. Everybody loves Hypnotoad. Good show. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="hc9KjFEf8ZPZMFyJqU8kX9" name="binky the clown" alt="Binky the Clown patting Garfield's head in Garfield and Friends" src="https://cdn.mos.cms.futurecdn.net/hc9KjFEf8ZPZMFyJqU8kX9.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Pluto TV)</span></figcaption></figure><h2 id="garfield-friends-the-binky-show">Garfield & Friends - "The Binky Show"</h2><p>Hey, kids! No fake TV clown seemed quite as intent on waking everyone in the hosue up as <em>Garfield & Friends</em>' Binky the Clown, whose show seemed to be on at literally all hours. Because it was of such high production value, I can only assume.</p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ Netflix's New Comedy From BoJack Horseman Creator Is One Of The Most Relatable Shows I've Ever Seen, Even Though I Don't Have Much In Common With The Characters ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/streaming-news/bojack-horseman-creator-netflix-comedy-long-story-short-relatable-family-drama</link>
                                                                            <description>
                            <![CDATA[ Family life can be both universal and wildly singular. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">2s9d6pMyNSZVbYRs65KSCk</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/fcJ5sJeoaxJityYe3enLdb-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Tue, 26 Aug 2025 20:01:00 +0000</pubDate>                                                                                                                                                                                                                                <category><![CDATA[Streaming News]]></category>
                                                                                                                    <dc:creator><![CDATA[ Nick Venable ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/TzeQjfZT5cKqHRsEqudtqT.png ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Nick Venable is an Assistant Managing Editor, and the TV Editor. His humble origin story with CinemaBlend began all the way back in the pre-streaming era, circa 2009, as a freelancing DVD reviewer and TV recapper. After rising up through the ranks covering Movies, Nick leapfrogged over to the small screen to cover more and more television news and interviews, eventually taking over the section for the current era. Born in Louisiana and currently living in Texas — Who Dat Nation over America’s Team all day, all night — Nick spent several years in the hospitality industry, and also worked as a 911 operator. And if you ever happened to hear his music or read his comics/short stories, you have his sympathy. His love for his wife and daughters is almost equaled by his love of gasp-for-breath laughter and gasp-for-breath horror. A lifetime spent in the vicinity of a television screen led to his current dream job, as well as his knowledge of too many TV themes and ad jingles.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What He&#039;s Into&lt;/strong&gt;: Nick is one of those people who won’t necessarily insert a Monty Python reference into every conversation, but is still mentally equipped to do so. Beyond such appreciation for surreal UK comedy, Nick also indulges in as much horror splendor as possible, from Stephen King novels to James Tynion IV comics to Freddy Krueger one-liners to all things Mike Flanagan. Throw in a dash of NFL, some 311 and Weird Al, fried crawfish poboys, bourbon, ‘90s-era pro wrestling, crossword puzzles and mystery-driven video games, and baby, you got a stew going. (Nick will insert an Arrested Development reference into every conversation, if possible.)&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What He&#039;s Excited About&lt;/strong&gt;: Anything Jeff Lemire, Tom King and W. Maxwell Prince think of, ever. More of Kelly Reilly’s deliriously fierce performances on Yellowstone. HBO’s The Last of Us. Clone High’s return. Colin Farrell’s Penguin being in every movie/TV show/breakfast cereal.&lt;/p&gt; ]]></dc:description>
                                                                                                                                <cf:isSponsored>false</cf:isSponsored>
                <cf:hasAffiliateLinks>false</cf:hasAffiliateLinks>
                <cf:isPaid>false</cf:isPaid>
                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/fcJ5sJeoaxJityYe3enLdb-1280-80.jpg">
                                                            <media:credit><![CDATA[Netflix]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[Schwooper family upset during car ride in Long Story Short ]]></media:description>                                                            <media:text><![CDATA[Schwooper family upset during car ride in Long Story Short ]]></media:text>
                                <media:title type="plain"><![CDATA[Schwooper family upset during car ride in Long Story Short ]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/fcJ5sJeoaxJityYe3enLdb-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p><strong>Mild spoilers below for the animated series </strong><em><strong>Long Story Short</strong></em><strong> for anyone who hasn’t yet streamed the comedy via </strong><a href="https://www.cinemablend.com/streaming-news/netflix-subscription-the-plans-the-price-and-whats-included"><strong>Netflix subscription</strong></a><strong>.</strong></p><p><em>Long Story Short</em> is the aptly named <a href="https://www.cinemablend.com/streaming-news/bojack-horseman-creator-new-netflix-show-comedically-traumatic">new animated comedy from Raphael Bob-Waksberg</a>, the mastermind behind one of <a href="https://www.cinemablend.com/television/100-best-tv-sitcoms-of-all-time-ranked">TV’s all-time best sitcoms</a>, <em>BoJack Horseman</em>, though it is more readily comparable to the weepy hourlong drama <em>This Is Us</em> than the anthropomorphic celebrity-skewing satire. The laughs are evident and plentiful, don’t get me wrong, but the timeline-spanning narrative device allows for a deeper sense of pathos than ‘toons usually provide, allowing audiences to become one with the dysfunctional Schwooper family. </p><p>I knew I would love this show, largely because of Bob-Waksberg’s involvement, but also because of the stacked and hilarious cast, including Abbi Jacobson, Max Greenfield, Ben Feldman, Angelique Cabral, Nicole Byer, Paul Reiser and Lisa Edelstein. (Not to mention the surprising number of familiar guest stars.) What I didn’t expect, however, was that I’d find nearly every single episode vastly relatable in one way or another, despite having a drastically different upbringing and family dynamic. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="w96aJH7peVQQdPbjsCiddb" name="Long Story Short game night" alt="Schwooper family playing a game in Long Story Short" src="https://cdn.mos.cms.futurecdn.net/w96aJH7peVQQdPbjsCiddb.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="long-story-short-is-vastly-different-from-bojack-but-with-a-similarly-embattled-emotional-core">Long Story Short Is Vastly Different From BoJack, But With A Similarly Embattled Emotional Core</h2><p>With one of the most unique storytelling devices of any series on the <a href="https://www.cinemablend.com/television/2025-tv-premiere-date-schedule-upcoming-new-returning-shows">2025 TV schedule</a>, <em>Long Story Short</em> delivers episodes focusing on major life events for the Schwooper family members, jumping back and forth through time to showcase all the relevant character moments and details that matter the most, across childhoods, teen years, middle-aged existences and then some. A few <em>BoJack</em>-friendly comedic motifs such as tongue-twister wordplay and callback jokes are present throughout the first season, but for the most part, this is thematically and aesthetically worlds away from Hollywoo. </p><p>That said, <em>Long Story Short</em> does at times feel like a less depressing extension of BoJack’s own sordid family history, at least in terms of helping build empathy and compassion for the characters. (The fleeting looks at Naomi’s childhood were probably closer to the Horseman family’s past than I’d be comfortable thinking about.) But by limiting the fucked-up and <a href="https://www.cinemablend.com/movies/movies-tv-shows-that-make-comedy-out-of-dark-situations">inherently dark nature of its comedy</a>, the new series becomes that much more relatable to audiences at large, and not just four-legged former sitcom stars. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="rMfj46wRWfD5W3TrmDQ3db" name="Long Story Short kids in car" alt="Walter and Benjamin locking Shira and Kendra out of the car in Long Story Short" src="https://cdn.mos.cms.futurecdn.net/rMfj46wRWfD5W3TrmDQ3db.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="i-technically-have-little-in-common-with-the-schwoopers-but-i-easily-relate-to-their-emotional-journeys">I Technically Have Little In Common With The Schwoopers, But I Easily Relate To Their Emotional Journeys</h2><p>I could spend quite a while naming all the ways my life doesn't directly compare to the Schwoopers. For one, I'm from the South, and thus am not Jewish and don't knowingly have any Jewish ancestors, and bar/bat mitzvahs are Greek (orthodox) to me. I only have one sibling, and while my sister and I are both still married (to other people, natch) with two kids each, neither of us are part of a mixed-race couple, and no one in my immediate family went through IVF treatments. My dad died when I was a teenager, so I never quite got to see my parents get old together. And so on, and so on. </p><p>Despite all of the differerences that can be found under the microscope, however, each of this show's titular stories can really be whittled down to the most elemental and core concept of family, which is one of the most relatable topics imaginable, biological or otherwise. In that vein, I know all to well what it's like to be elated, disappointed, frustrated, gobsmacked and more by familiy members, which aligns squarely with how <em>Long Story Short</em>'s characters react to each other, sometimes with all emotions emerging at once. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="xJGSRiicW9SoBxabgxvdzc" name="Long Story Short Naomi and Elliot" alt="Naomi and Elliot horrified during bar mitzvah in Long Story Short" src="https://cdn.mos.cms.futurecdn.net/xJGSRiicW9SoBxabgxvdzc.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="i-do-know-what-it-s-like-to-have-and-love-an-outspokenly-judgmental-and-demanding-mother">I Do Know What It's Like To Have (And Love) An Outspokenly Judgmental And Demanding Mother</h2><p>Lisa Edelstein delivers an award-worthy performance as Naomi, a character with a tireless ability to dish out captious criticisms regardless of how ill-advised and unwelcomed such words might be. In some ways, Naomi taps into the "Jewish TV mom" stereotypes that even she'd call out as being reductive, but instead of making sure the actors use distinct voices to speak one at a time, <em>Long Story Short</em> allows its cast members to get loud and talk all over each other. It's enough to cause immediate blood pressure spikes, as my own mother was like Naomi at 80-85% strength. (Sorry, lady.)</p><p>I can so relate to having discussions with a sibling about how to break a piece of news to one's mother in a way that will draw the weakest amount of blowback. I know quite well what it's like to receive compliments only when couched between nitpicks. Never did I ever doubt the immense love lurking behind her critical snipes, though, knowing that's where it all surfaced from, similar to Naomi's desire for attention coming from a non-hateful place. She's a mom. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="nUcWhRPzNyeqE9QxprDHcb" name="Long Story Short Avi dad moment" alt="Avi and Hannah looking at phone in Long Story Short" src="https://cdn.mos.cms.futurecdn.net/nUcWhRPzNyeqE9QxprDHcb.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="long-story-short-is-a-hilarious-and-stressful-reminder-to-make-the-best-memories-possible-while-you-still-can">Long Story Short Is A Hilarious And Stressful Reminder To Make The Best Memories Possible While You Still Can</h2><p>You can pick your friends and lovers, but you can't pick your family, and as <em>Long Story Short</em> proves, we don't always have the best judgment when picking those friends and lovers, so it's always key to remember what's most important. The Season 1 finale is as much a reminder as any episode that life often goes completely against our plans and desires, and can even make an already difficult time of mourning even more soul-crushing. (Like, say, with a global pandemic.)</p><p>Not every animated comedy will make you want to call your parents, siblings, estranged spouse, children just to make sure they know you appreciate them. In fact, there are <em>very</em> few series that fit that description, which further helps make <em>Long Story Short</em> stand out among the masses. I might not be itching to talk to any exes about botched prom plans and other icky memories, but if it means hearing about a fun moment I wasn't aware of before, so be it. We only live once, and there's no flashback button. </p><p>I can only hope that more animated projects look to this show and the <a href="https://www.cinemablend.com/interviews/why-king-of-the-hill-revival-explicitly-not-trying-make-you-feel-nostalgic"><em>King of the Hill </em> revival's aged-up timeline</a> as proof that audiences can still follow along and relate to animated characters even if they don't eternally remain the same age. In fact, it's far easier that way, although maybe that's just my own age showing. </p><p><em>Long Story Short</em> is available to stream on Netflix. Let's try to keep the Schwoopers around for more than just one season, how 'bout it?</p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ 32 Fictional TV Hosts We Wish Were Real  ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/movies/fictional-tv-hosts-we-wish-were-real</link>
                                                                            <description>
                            <![CDATA[ And, we're back... ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">7W74nY5fxL8uVYRbRXu8nU</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/dytuxPJuAUJNk6uNLK2yT8-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Tue, 29 Jul 2025 15:31:00 +0000</pubDate>                                                                                                                                                                                                                                <category><![CDATA[Movies]]></category>
                                                                                                                    <dc:creator><![CDATA[ Jason Wiese ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/62SRu9Bi2SyJGrpzKXAfsK.jpg ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Jason Wiese writes feature stories for CinemaBlend. His occupation results from years dreaming of a filmmaking career, settling on a &quot;professional film fan&quot; career, studying journalism at Lindenwood University in St. Charles, MO (where he served as Culture Editor for its student-run print and online publications), and a brief stint of reviewing movies for fun. He would later continue that side-hustle of film criticism on TikTok (@wiesewisdom), where he posts videos on a semi-weekly basis.&lt;/p&gt;&lt;p&gt;&lt;br&gt;&lt;/p&gt;&lt;p&gt;Jason has been writing since he was able to pick up a washable marker, with which he wrote his debut illustrated children&#039;s story, later transitioning to a short-lived comic book series and (very) amateur filmmaking before finally settling on pursuing a career in writing about movies in lieu of making them. Look for his name in almost any article about Batman.&lt;/p&gt;&lt;p&gt;&lt;br&gt;&lt;/p&gt;&lt;p&gt;&lt;strong&gt;What He&#039;s Into&lt;/strong&gt;: Readers may notice a recurring theme of horror and superhero-related content (especially in regards to Batman) in much of Jason&#039;s work, but his favorite film of all time is more in line with traditional action/adventure stories: &lt;em&gt;Raiders of the Lost Ark&lt;/em&gt;. His favorite TV series is the gritty, grounded crime thriller &lt;em&gt;Breaking Bad&lt;/em&gt; and if you catching him reading anything, it is probably a comic book (and, more often than not, one featuring Batman). More important to him than entertainment, however, are his wife and two dogs.&lt;/p&gt;&lt;p&gt;&lt;br&gt;&lt;/p&gt;&lt;p&gt;&lt;strong&gt;What He&#039;s Excited About Right Now&lt;/strong&gt;: Jason typically tries to keep his excitement and expectations for any upcoming movies as low as possible, but he is certainly looking forward to returning to Matt Reeves&#039; vision of Gotham City in the upcoming follow-up to &lt;em&gt;The Batman&lt;/em&gt; and just about any horror movie set to haunt cinemas soon.&lt;/p&gt; ]]></dc:description>
                                                                                                                                <cf:isSponsored>false</cf:isSponsored>
                <cf:hasAffiliateLinks>false</cf:hasAffiliateLinks>
                <cf:isPaid>false</cf:isPaid>
                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/dytuxPJuAUJNk6uNLK2yT8-1280-80.jpg">
                                                            <media:credit><![CDATA[HBO]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[Garry Shandling on The Larry Sanders Show]]></media:description>                                                            <media:text><![CDATA[Garry Shandling on The Larry Sanders Show]]></media:text>
                                <media:title type="plain"><![CDATA[Garry Shandling on The Larry Sanders Show]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/dytuxPJuAUJNk6uNLK2yT8-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>As a student of journalism, a lifelong avid TV watcher, and a fan of <a href="https://www.cinemablend.com/television/2475790/ranking-stephen-colbert-jimmy-fallon-jimmy-kimmel-and-all-the-other-current-late-night-hosts">late-night TV hosts</a>, I have always been fascinated by the way television personalities are depicted in fiction. Sometimes these characters represent the best that the media can offer, while others serve as a mockery of the profession. Either way, I can’t get enough of them, and these are some of my favorites.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="W3bmEJjQDCxSSZSpEV94NK" name="Anchorman The Legend of Ron Burgundy Will Ferrell smiles confidently at the news desk.jpg" alt="Will Ferrell smiles confidently at the news desk in Anchorman The Legend of Ron Burgundy." src="https://cdn.mos.cms.futurecdn.net/W3bmEJjQDCxSSZSpEV94NK.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: DreamWorks Pictures)</span></figcaption></figure><h2 id="ron-burgundy-anchorman-the-legend-of-ron-burgundy">Ron Burgundy (Anchorman: The Legend Of Ron Burgundy)</h2><p>Most would agree that the <a href="https://www.cinemablend.com/new/15-Best-Ferrell-Characters-Ranked-70446.html">best Will Ferrell character</a> has to be the title role of his 2004 favorite, <em>Anchorman: The Legend of Ron Burgundy</em>. The former <em>SNL</em> star actually gave the world a taste of what it would be like if the charismatic, scotch-loving teleprompter loyalist were a real person when he hosted <a href="https://www.iheart.com/podcast/1119-the-ron-burgundy-podcast-30270227/"><em>The Ron Burgundy Podcast</em></a>.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="ZufS5wSjtGxattLAvNq5BS" name="Jean_Smart_Hacks_2.jpg" alt="Jean Smart in Season 3 of Hacks on HBO Max." src="https://cdn.mos.cms.futurecdn.net/ZufS5wSjtGxattLAvNq5BS.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: HBO )</span></figcaption></figure><h2 id="deborah-vance-hacks">Deborah Vance (Hacks)</h2><p>Jean Smart has won multiple Emmys for her role in the HBO Max original comedy series, <em>Hacks</em>, as Deborah Vance, the host of <em>Late Night</em> and a hilarious, pitch-perfect representation of the business' intense, cutthroat nature.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="MCW3868zU8ENLPFqYCY6wJ" name="alanpartridgealphapapastevecoogan" alt="Steve Coogan in a recording studio in Alan Partridge: Alpha Papa" src="https://cdn.mos.cms.futurecdn.net/MCW3868zU8ENLPFqYCY6wJ.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: StudioCanal)</span></figcaption></figure><h2 id="alan-partridge-various">Alan Partridge (Various)</h2><p>Steve Coogan has portrayed Alan Partridge, the uproariously inept British TV personality he created with Armando Iannucci, in various projects. He debuted on the BBC radio program <em>On the Hour</em>, received his own mockumentary-style chat show <em>Knowing Me, Knowing You with Alan Partridge</em>, led a sitcom called <em>I'm Alan Partridge</em>, and was the focus of a 2013 feature film called <em>Alan Partridge: Alpha Papa</em>, in which he is forced to be a hostage negotiator.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="KGJdpMmfaWC6xFa3FELkNN" name="murphy brown.png" alt="candice bergen on murphy brown" src="https://cdn.mos.cms.futurecdn.net/KGJdpMmfaWC6xFa3FELkNN.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBS)</span></figcaption></figure><h2 id="murphy-brown-murphy-brown">Murphy Brown (Murphy Brown)</h2><p>The eponymous lead character from the long-running, beloved sitcom, <em>Murphy Brown</em>, is not only one of multi-Emmy-winning Candice Bergen's most iconic characters, but one of the most influential fictional female figures in news media, depicted as a trailblazer in her profession.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="zcZTPxc6wLwohw7cWomqhg" name="Network Peter Finch stands in the newsroom looking mad as hell.jpg" alt="Peter Finch stands in the newsroom, looking mad as hell, in Network." src="https://cdn.mos.cms.futurecdn.net/zcZTPxc6wLwohw7cWomqhg.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Warner Bros.)</span></figcaption></figure><h2 id="howard-beale-network">Howard Beale (Network)</h2><p>Originally released in 1976, <a href="https://www.cinemablend.com/movies/rewatched-network-disturbing-just-how-relevant-it-still-is-but-thats-not-all-took-away-from-it-this-time"><em>Network</em> remains a disturbingly relevant commentary</a> on news media and society in general, with much credit due to Peter Finch's bold, Oscar-winning performance as Howard Beale. That being said, you rarely hear of a broadcast journalist being as boldly direct and brutally honest about their feelings as he is these days.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="hc7X9V8dida4GZjEqt4xtd" name="Screen Shot 2022-08-16 at 10.19.40 AM.png" alt="Courteney Cox in Scream (2022)" src="https://cdn.mos.cms.futurecdn.net/hc7X9V8dida4GZjEqt4xtd.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Paramount Pictures)</span></figcaption></figure><h2 id="gale-weathers-scream">Gale Weathers (Scream)</h2><p>In 1996's <a href="https://www.cinemablend.com/movies/best-slasher-horror-movies-and-how-to-watch">slasher movie favorite</a>, <em>Scream</em>, Gale Weathers (Courteney Cox) was your typical sleazy, self-serving gossip reporter, but would slowly evolve into a professional with some tact in the sequels. Not to mention, few people in her field can claim to have the kind of first-hand experience with the deadly topics she discusses, having survived several <a href="https://www.cinemablend.com/movies/the-scream-movies-the-villains-behind-every-ghostface-so-far">Ghostface killers</a> over the years.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="URFQXrD85CsgRMJLeoFtsD" name="mikemyerssnlmonkeyfly.jpg" alt="Mike Myers and Dana Carvey on SNL" src="https://cdn.mos.cms.futurecdn.net/URFQXrD85CsgRMJLeoFtsD.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="wayne-campbell-and-garth-algar-wayne-s-world">Wayne Campbell And Garth Algar (Wayne's World)</h2><p>Local cable access television had never been as cool (or cool at all, really) before Mike Myers and Dana Carvey debuted as Wayne Campbell and Garth Algar, who later became the stars of two <a href="https://www.cinemablend.com/streaming-news/every-movie-based-on-snl-characters-ranked">beloved movies based on the <em>Saturday Night Live</em> sketch</a> from which they originated.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="h6DpCVyAxAXYmxGqyCsczA" name="White-1 (1).jpg" alt="Betty White on the Mary Tyler Moore Show." src="https://cdn.mos.cms.futurecdn.net/h6DpCVyAxAXYmxGqyCsczA.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBS)</span></figcaption></figure><h2 id="sue-ann-nivens-the-mary-tyler-moore-show">Sue Ann Nivens (The Mary Tyler Moore Show)</h2><p>Betty White was brilliant on <em>The Mary Tyler Moore Show</em> as Sue Ann Nivens, balancing her perky, kindly on-camera persona as host of <em>The Happy Homemaker</em> with her vindictive and highly competitive off-screen personality with incredible ease.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="2QhS4D5LYcX9s5FTpjiEeA" name="himymrobinnews" alt="Cobie Smulders as Robin Scherbatsky delivering the news on How I Met Your Mother" src="https://cdn.mos.cms.futurecdn.net/2QhS4D5LYcX9s5FTpjiEeA.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBS)</span></figcaption></figure><h2 id="robin-scherbatsky-how-i-met-your-mother">Robin Scherbatsky (How I Met Your Mother)</h2><p>Robin Scherbatsky, <a href="https://www.cinemablend.com/television/2474932/how-i-met-your-mother-whats-the-cast-up-to-now"><em>How I Met Your Mother</em> cast</a> member Cobie Smulders' role on the hit sitcom, is a real go-getter in the world of broadcast journalism. She always opted to put her career before everything else, even if it cost her a few chances in the department of romance. At least, that was the case in earlier seasons.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="VsqEE6VDVoSqHT8ts8ykTK" name="larrysanderswince" alt="Garry Shandling on The Larry Sanders Show" src="https://cdn.mos.cms.futurecdn.net/VsqEE6VDVoSqHT8ts8ykTK.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: HBO)</span></figcaption></figure><h2 id="larry-sanders-the-larry-sanders-show">Larry Sanders (The Larry Sanders Show)</h2><p>During its run from 1992 to 1998 on HBO, few comedy series had a sharper satirical outlook on show business than the Emmy-winning <em>The Larry Sanders Show</em>. Co-creator Garry Shandling starred as the titular late-night talk show host, who is constantly at odds with behind-the-scenes shenanigans courtesy of staff members and <a href="https://www.cinemablend.com/movies/hilarious-times-where-celebrities-played-wildly-exaggerated-versions-of-themselves">celebrities playing wild versions of themselves</a>.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="yC5cf38D2PtUtMGybrPvzg" name="jokermurray" alt="Robert De Niro in Joker" src="https://cdn.mos.cms.futurecdn.net/yC5cf38D2PtUtMGybrPvzg.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Warner Bros. / DC)</span></figcaption></figure><h2 id="murray-franklin-joker">Murray Franklin (Joker)</h2><p>It is fitting that Robert De Niro stars in a DC Comics adaptation that heavily borrows from some of his grittiest roles, especially <em>Taxi Driver</em>'s Travis Bickle. The acting legend appears in 2019's <em>Joker</em> opposite Joaquin Phoenix's Academy Award-winning role of Arthur Fleck as Murray Franklin, the host of the Gotham-based late-night program, <em>Live!</em>, who might not have survived the airwaves today with his meanspiritedness. Yet, I can't help but respect his bold approach to humor and showcasing risque topics.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="ygpi6W8cCyREkS33ktiriY" name="Kent quote" alt="Kent Brockman smiling at the camera and wearing a green suit" src="https://cdn.mos.cms.futurecdn.net/ygpi6W8cCyREkS33ktiriY.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Fox)</span></figcaption></figure><h2 id="kent-brockman-the-simpsons">Kent Brockman (The Simpsons)</h2><p>One of Harry Shearer's funniest characters on <em>The Simpsons</em> is Kent Brockman, a Springfield-based TV editorialist who has no filter when it comes to sounding off his typically judgmental opinions.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="Jq9HMvJkqQa8Tm69Ndu4pb" name="anchorman ron and veronica on news" alt="Will Ferrell and Christina Applegate sitting next to each other at the new desk." src="https://cdn.mos.cms.futurecdn.net/Jq9HMvJkqQa8Tm69Ndu4pb.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: DreamWorks)</span></figcaption></figure><h2 id="veronica-corningstone-anchorman-the-legend-of-ron-burgundy">Veronica Corningstone (Anchorman: The Legend Of Ron Burgundy)</h2><p>If <em>Anchorman: The Legend of Ron Burgundy</em> actually was inspired by a true story, as it (sort of) claims at the very beginning, Veronica Corningstone (Christina Applegate) would have undoubtedly gone down in history as one of the most important figures of women's progress in the world of broadcast news.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="JYnYNUSgrphacWU6xsKPzn" name="Untitled design (8).jpg" alt="David Dastmalchian as Jack Delroy in Late Night with the Devil." src="https://cdn.mos.cms.futurecdn.net/JYnYNUSgrphacWU6xsKPzn.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: IFC Films/Shudder)</span></figcaption></figure><h2 id="jack-delroy-late-night-with-the-devil">Jack Delroy (Late Night With The Devil)</h2><p>David Dastmalchian gives one of his career-best performances as infamous TV legend <a href="https://www.cinemablend.com/interviews/does-late-night-with-the-devil-jack-delroy-believe-supernatural-david-dastmalchian-digs-mind-talk-show-host">Jack Delroy, who has a life-changing brush with the supernatural</a> in <em>Late Night with the Devil</em>. I imagine I would have been a fan of the <em>Nite Owls</em> host, at least right up until the night he brings his program to a screeching halt by conjuring a demonic spirit during a live broadcast on Halloween 1977.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="zEiMBvvTCH2rqiAdt3dLHc" name="The Running Man 2" alt="Richard Dawson throwing out his arms in The Running Man" src="https://cdn.mos.cms.futurecdn.net/zEiMBvvTCH2rqiAdt3dLHc.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Tri-Star Pictures)</span></figcaption></figure><h2 id="damon-killian-the-running-man">Damon Killian (The Running Man)</h2><p>I believe the eponymous, deadly reality competition show from the <a href="https://www.cinemablend.com/news/2572453/adapting-stephen-king-the-running-man-arnold-schwarzenegger-movie-least-stephen-king-film">1987 adaptation of Stephen King's dystopian novel, <em>The Running Man</em></a>, is abhorrent, and I pray it never becomes a reality. However, one thing I can commend it for is hiring a host as charismatic and enthusiastic as Damon Killian, played by former <a href="https://www.cinemablend.com/television/2475953/ranking-all-the-family-feud-hosts-from-richard-dawson-to-steve-harvey"><em>Family Feud</em> emcee</a> Richard Dawson.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="GHjXrQqAXc22Ljsws3u9zf" name="newsroomjeffdaniels" alt="Jeff Daniels on The Newsroom" src="https://cdn.mos.cms.futurecdn.net/GHjXrQqAXc22Ljsws3u9zf.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: HBO)</span></figcaption></figure><h2 id="will-mcavoy-the-newsroom">Will McAvoy (The Newsroom)</h2><p>Jeff Daniels' Emmy-winning role as Will McAvoy on creator Aaron Sorkin's <em>The Newsroom</em> had the courage to call out dishonesty and corruption when few others would dare, which is a quality more TV journalists in the real world could certainly benefit from.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="P9CBBsPiEqeRo7AZdRxFTY" name="Carvey" alt="Dana Carvey smiles at the camera while playing The Church Lady on SNL." src="https://cdn.mos.cms.futurecdn.net/P9CBBsPiEqeRo7AZdRxFTY.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC/ Saturday Night Live)</span></figcaption></figure><h2 id="enid-the-church-lady-strict-saturday-night-live">Enid "The Church Lady" Strict (Saturday Night Live)</h2><p>Dana Carvey is the actor behind a few of the <a href="https://www.cinemablend.com/television/funniest-reoccurring-characters-saturday-night-live">funniest recurring <em>Saturday Night Live</em> characters</a>, including, arguably, his signature role as Enid "The Church Lady" Strict. No matter how many times she uttered her signature catchphrases, the host of a faith-based talk show called <em>Church Chat</em>, which was mainly devoted to accusing her guests of worshipping Satan, was always a joy to laugh at, which certainly makes her "special."</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="jBgt8NuNN4FsttKcF49XtT" name="conanspaceghost.jpg" alt="Space Ghost talking to Conan O'Brien" src="https://cdn.mos.cms.futurecdn.net/jBgt8NuNN4FsttKcF49XtT.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Adult Swim)</span></figcaption></figure><h2 id="space-ghost-space-ghost-coast-to-coast">Space Ghost (Space Ghost Coast To Coast)</h2><p>Making a relatively obscure Hanna-Barbera cartoon character the host of his own talk show, featuring real-life celebrity guests, is a pretty random idea, I will admit. That being said, how cool would it be if a superhero actually did broadcast a talk show from outer space, like on <em>Space Ghost Coast to Coast</em>?</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="UKi3E6LVc2Xg2JAHYQPJr" name="latenightthompson" alt="Late Night with Emma Thompson" src="https://cdn.mos.cms.futurecdn.net/UKi3E6LVc2Xg2JAHYQPJr.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Amazon Studio)</span></figcaption></figure><h2 id="katherine-newbury-late-night">Katherine Newbury (Late Night)</h2><p>The 2019 comedy film <em>Late Night</em> takes audiences behind the scenes of the world of late-night TV, focusing on the unlikely bond between the eponymous host of <em>Tonight with Katherine Newbury</em>, played by Emma Thompson, and one of her writers, Molly Patel (Mindy Kaling).</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="9DvqZcicCiYStDvTaBhuiP" name="parksandrecperd" alt="Jay Jackson as Perd Hapley on Parks and Recreation" src="https://cdn.mos.cms.futurecdn.net/9DvqZcicCiYStDvTaBhuiP.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="perd-hapley-parks-and-recreation">Perd Hapley (Parks And Recreation)</h2><p>A <a href="https://www.cinemablend.com/television/Parks-Recreation-30-Greatest-Random-Pawnee-Side-Characters-70267.html"><em>Parks and Recreation</em> side character</a> whom I cannot get enough of is Perd Hapley (Jay Jackson), the host of the brilliantly titled program, <em>Ya Heard? with Perd. </em>I would watch the Pawnee, Indiana-based, hilariously matter-of-fact broadcaster religiously if his show were real.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="dfWPK53FWuMXkEgVL7j7Lm" name="vstephenfry" alt="Stephen Fry as Gordon Deitrich in V For Vendetta" src="https://cdn.mos.cms.futurecdn.net/dfWPK53FWuMXkEgVL7j7Lm.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Warner Bros.)</span></figcaption></figure><h2 id="gordon-deitrich-v-for-vendetta">Gordon Deitrich (V For Vendetta)</h2><p>The 2005 adaptation of legendary comic book writer Alan Moore's dystopian graphic novel, <em>V for Vendetta</em>, is a deeply bleak story, but it does manage to maintain a few glimmers of hope in the form of characters like Gordon Deitrich. The comedian, played by Stephen Fry, is literally murdered for his willingness to mock the United Kingdom's fascist leader, Adam Sutler (John Hurt), on his satirical program.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="uUV7kHmcGNxTGuGH3k2FT8" name="Jennifer Aniston in The Morning Show" alt="Jennifer Aniston in The Morning Show" src="https://cdn.mos.cms.futurecdn.net/uUV7kHmcGNxTGuGH3k2FT8.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Apple TV+)</span></figcaption></figure><h2 id="alex-levy-the-morning-show">Alex Levy (The Morning Show)</h2><p>Jennifer Aniston would not be who she is if not for her role in the <a href="https://www.cinemablend.com/television/2474356/what-have-the-friends-cast-been-up-to-since-the-show-ended"><em>Friends</em> cast</a> as Rachel Green, but the actor has never quite given a performance as powerful as that of Alex Levy on the acclaimed <a href="https://www.cinemablend.com/television/2566890/the-best-apple-tv-shows-to-watch-including-ted-lasso">Apple TV+ original TV show</a>, <em>The Morning Show</em>. The consummate professional makes it a personal goal of hers to maintain control of the eponymous news program she has anchored for years when her share of the power over it begins to fall through the cracks.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="zvXZQXfY6WxH3upFpsQAC8" name="molshan.jpg" alt="Pat Dubek worried in The Other Two" src="https://cdn.mos.cms.futurecdn.net/zvXZQXfY6WxH3upFpsQAC8.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Max)</span></figcaption></figure><h2 id="pat-dubek-the-other-two">Pat Dubek (The Other Two)</h2><p>Molly Shannon's character on the Emmy-nominated Comedy Central series, <em>The Other Two</em>, makes her show, <em>Pat! The Pat Dubek Show,</em> a memorable experience with her endlessly upbeat demeanor and willingness to take phone calls from her children, including her world-famous pop star son, while on the air.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="WEK2ymXoSpF89Zq2WMQsUT" name="bojackwhale" alt="Keith Olbermann as Tom Jumbo-Grumbo from Bojack Horseman" src="https://cdn.mos.cms.futurecdn.net/WEK2ymXoSpF89Zq2WMQsUT.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="tom-jumbo-grumbo-bojack-horseman">Tom Jumbo-Grumbo (Bojack Horseman)</h2><p>One of the key elements that makes Netflix's show business satire <em>Bojack Horseman</em> one of the <a href="https://www.cinemablend.com/television/the-75-best-animated-TV-shows-of-all-time">best animated TV shows</a> of all time is the incredible line-up of surprising talents in the voice cast. For instance, former MSNBC commentator Keith Olbermann lends his voice to several episodes as a talking, anthropomorphic whale named Tom Jumbo-Grumbo, who is a host for the network MSNBSea.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="AQH3fq5r5dLopR74yR7dAc" name="kenan.jpg" alt="Kenan Thompson on Saturday Night Live" src="https://cdn.mos.cms.futurecdn.net/AQH3fq5r5dLopR74yR7dAc.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBCUniversal)</span></figcaption></figure><h2 id="diondre-cole-saturday-night-live">Diondre Cole (Saturday Night Live)</h2><p>There are many celebrities who have a good reason to be annoyed by Diondre Cole, the host of a unique BET discussion program called <em>What Up With That?</em>, especially former Fleetwood Mac guitarist Lindsey Buckingham (portrayed by Bill Hader). However, I personally cannot get enough of Kenan Thompson's hilarious recurring <em>Saturday Night Live</em> character and his unparalleled energy, no matter how terribly he struggles to conduct an interview without rudely interrupting his guests with another banging jam session.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="uHPhLusqp5KfNY52sc2reT" name="LoriLoughlinandBobSaget.jpg" alt="Lori Loughlin and Bob Saget on Full House" src="https://cdn.mos.cms.futurecdn.net/uHPhLusqp5KfNY52sc2reT.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Jeff Franklin Productions)</span></figcaption></figure><h2 id="danny-tanner-and-rebecca-donaldson-full-house">Danny Tanner And Rebecca Donaldson (Full House)</h2><p>At the beginning of the long-running family sitcom <em>Full House</em>, Bob Saget's character, widowed single father Danny Tanner, was introduced as a TV news reporter. In later seasons, he becomes the co-host of a local morning talk show called <em>Wake Up, San Francisco</em>, alongside Rebecca Donaldson (Lori Loughlin), who would eventually become his housemate when she marries his brother-in-law, Jesse (John Stamos).</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="xLmzoZz45RxyepdH4XzEe3" name="websterwithgeorge" alt="Webster and George on Webster" src="https://cdn.mos.cms.futurecdn.net/xLmzoZz45RxyepdH4XzEe3.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><h2 id="george-papadopolis-webster">George Papadopolis (Webster)</h2><p>Alex Karras' character from the hit sitcom, <em>Webster</em>, in which he and his wife, Katherine (Susan Clark), become the guardians to their young godson (played by Emmanuel Lewis), must not have been much of a challenge for him to portray. Much like Karras himself, George Papadopolis was a former professional football player who went on to have a career in broadcasting.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="taLoWnQQc2t6nV6GffcYKZ" name="parksandreckarate" alt="Chris Pratt in Parks and Recreation" src="https://cdn.mos.cms.futurecdn.net/taLoWnQQc2t6nV6GffcYKZ.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="andy-johnny-karate-dwyer-parks-and-recreation">Andy "Johnny Karate" Dwyer (Parks And Recreation)</h2><p>In later seasons of NBC's beloved mockumentary sitcom, <em>Parks and Recreation,</em> Chris Pratt's character, Andy, becomes the host of his own children's program. His alter ego, Johnny Karate, is someone I think I would have loved to grow up with, and I probably would have shown him to my children as well.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="Fje7LGDQwUtuaeciV7Z9m3" name="atlantamontague" alt="Alano Miller as Franklin Montague on Atlanta" src="https://cdn.mos.cms.futurecdn.net/Fje7LGDQwUtuaeciV7Z9m3.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: FX)</span></figcaption></figure><h2 id="franklin-montague-atlanta">Franklin Montague (Atlanta)</h2><p>One of the <a href="https://www.cinemablend.com/television/2547564/the-best-atlanta-episodes-ranked">best episodes of <em>Atlanta</em></a>, the clever, experimental, Emmy-winning "B.A.N.," is structured to appear as a snippet of programming from the eponymous network with a focus on Black audiences. Alano Miller guest stars as Franklin Montague, the host of his own self-titled talk show on B.A.N., who is clearly guilty of baiting his guests with combative rhetoric, but at least he manages to keep his show interesting.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="HnC9GxdhRq7t9HdtuYwdMM" name="rodneydangerfieldmeetwallysparks.jpg" alt="Rodney Dangerfield in Meet Wally Sparks" src="https://cdn.mos.cms.futurecdn.net/HnC9GxdhRq7t9HdtuYwdMM.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: TriMark Pictures)</span></figcaption></figure><h2 id="wally-sparks-meet-wally-sparks">Wally Sparks (Meet Wally Sparks)</h2><p>While 1997's <em>Meet Wally Sparks</em> is widely considered to be one of the weaker of comedian Rodney Dangerfield's films, it is still a Rodney Dangerfield movie, after all. If the title character, a veteran tabloid television reporter, were real, I have no doubt that I would tune into his program on a regular basis just to hear him tell one of <a href="https://www.cinemablend.com/movies/absolutely-ridiculous-rodney-dangerfield-one-liners">his priceless one-liners</a>.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="EUDvLuNENgQoxwTSvKZVtF" name="snlbronxbeat.jpg" alt="Amy Poehler and Maya Rudolph on SNL" src="https://cdn.mos.cms.futurecdn.net/EUDvLuNENgQoxwTSvKZVtF.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="betty-caruso-and-jodi-deltz-saturday-night-live">Betty Caruso And Jodi Deltz (Saturday Night Live)</h2><p>One of the <a href="https://www.cinemablend.com/television/the-best-snl-character-catchphrases">funniest catchphrases from <em>Saturday Night Live</em></a> comes from Maya Rudolph as Jodi Deitz, who often complains about her husband's frequent tendencies for moronic behavior, only to tearfully proclaim, "But I love him!" In fact, Jodi's husband is one of various recurring topics that she and fellow New York housewife Betty Caruso (Amy Poehler) like to boisterously sound off on as the co-hosts of a local talk show called <em>Bronx Beat</em>.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="PNpgdX8BuudJNdGqwPDSf5" name="Screen Shot 2022-01-14 at 10.17.09 AM.png" alt="James Franco in The Interview" src="https://cdn.mos.cms.futurecdn.net/PNpgdX8BuudJNdGqwPDSf5.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Sony Pictures)</span></figcaption></figure><h2 id="dave-skylark-the-interview">Dave Skylark (The Interview)</h2><p>James Franco gives one of the funniest performances of his career in directors Seth Rogen and Evan Goldberg's 2014 comedy, <em>The Interview</em>, as Dave Skylark, who discovers that he is the favorite TV personality of none other than Kim Jong-Un (Randall Park). Little does the leader of North Korea know, however, that, after he invites the talk show host and his producer (played by Rogen) to visit his home, the CIA has recruited them to help carry out his assassination.</p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ Hilarious Times Where Celebrities Played Wildly Exaggerated Versions Of Themselves ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/movies/hilarious-times-where-celebrities-played-wildly-exaggerated-versions-of-themselves</link>
                                                                            <description>
                            <![CDATA[ They're not like this in real life, right? ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">qtQVj4zqeRKPZ3j8NEinXF</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/PYYGTrec5VCKtJ9JJsiJmA-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Mon, 26 May 2025 19:32:00 +0000</pubDate>                                                                                                                                                                                                                                <category><![CDATA[Movies]]></category>
                                                                                                                    <dc:creator><![CDATA[ Jason Wiese ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/62SRu9Bi2SyJGrpzKXAfsK.jpg ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Jason Wiese writes feature stories for CinemaBlend. His occupation results from years dreaming of a filmmaking career, settling on a &quot;professional film fan&quot; career, studying journalism at Lindenwood University in St. Charles, MO (where he served as Culture Editor for its student-run print and online publications), and a brief stint of reviewing movies for fun. He would later continue that side-hustle of film criticism on TikTok (@wiesewisdom), where he posts videos on a semi-weekly basis.&lt;/p&gt;&lt;p&gt;&lt;br&gt;&lt;/p&gt;&lt;p&gt;Jason has been writing since he was able to pick up a washable marker, with which he wrote his debut illustrated children&#039;s story, later transitioning to a short-lived comic book series and (very) amateur filmmaking before finally settling on pursuing a career in writing about movies in lieu of making them. Look for his name in almost any article about Batman.&lt;/p&gt;&lt;p&gt;&lt;br&gt;&lt;/p&gt;&lt;p&gt;&lt;strong&gt;What He&#039;s Into&lt;/strong&gt;: Readers may notice a recurring theme of horror and superhero-related content (especially in regards to Batman) in much of Jason&#039;s work, but his favorite film of all time is more in line with traditional action/adventure stories: &lt;em&gt;Raiders of the Lost Ark&lt;/em&gt;. His favorite TV series is the gritty, grounded crime thriller &lt;em&gt;Breaking Bad&lt;/em&gt; and if you catching him reading anything, it is probably a comic book (and, more often than not, one featuring Batman). More important to him than entertainment, however, are his wife and two dogs.&lt;/p&gt;&lt;p&gt;&lt;br&gt;&lt;/p&gt;&lt;p&gt;&lt;strong&gt;What He&#039;s Excited About Right Now&lt;/strong&gt;: Jason typically tries to keep his excitement and expectations for any upcoming movies as low as possible, but he is certainly looking forward to returning to Matt Reeves&#039; vision of Gotham City in the upcoming follow-up to &lt;em&gt;The Batman&lt;/em&gt; and just about any horror movie set to haunt cinemas soon.&lt;/p&gt; ]]></dc:description>
                                                                                                                                <cf:isSponsored>false</cf:isSponsored>
                <cf:hasAffiliateLinks>false</cf:hasAffiliateLinks>
                <cf:isPaid>false</cf:isPaid>
                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/PYYGTrec5VCKtJ9JJsiJmA-1280-80.jpg">
                                                            <media:credit><![CDATA[Warner Bros.]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[Neil Patrick Harris in Harold &amp; Kumar Go to White Castle]]></media:description>                                                            <media:text><![CDATA[Neil Patrick Harris in Harold &amp; Kumar Go to White Castle]]></media:text>
                                <media:title type="plain"><![CDATA[Neil Patrick Harris in Harold &amp; Kumar Go to White Castle]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/PYYGTrec5VCKtJ9JJsiJmA-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>It is never not a blast to see <a href="https://www.cinemablend.com/movies/amazing-celebrity-cameos-in-movies">celebrities make funny cameos</a> in movies or TV shows, or even appear in starring roles, as themselves, especially as a version of themselves that bears little resemblance to their actual personality. Take a look at some of the funniest examples of actors and other artists poking fun at themselves in a hilarious onscreen performance.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="Qhs9fiyrcHTNbhbqmtWi93" name="michaelcerathisistheend" alt="Michael Cera in This is the End" src="https://cdn.mos.cms.futurecdn.net/Qhs9fiyrcHTNbhbqmtWi93.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Sony)</span></figcaption></figure><h2 id="michael-cera-this-is-the-end">Michael Cera (This Is The End)</h2><p>Each member of the cast of 2013's <em>This Is the End</em> is a celebrity playing an exaggerated version of themselves, but the absolutely wildest of the bunch is Michael Cera. The actor plays dramatically against type as a destructive force of chaos at James Franco's house party... before destructive forces of chaos begin descending upon the entire Earth in Seth Rogen and Evan Goldberg's blistering apocalyptic satire.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="ZqTc4cq2tiKZtScaNzs9wB" name="kate winslet.jpg" alt="Kate Winslet on Extras" src="https://cdn.mos.cms.futurecdn.net/ZqTc4cq2tiKZtScaNzs9wB.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: HBO / BBC)</span></figcaption></figure><h2 id="kate-winslet-extras">Kate Winslet (Extras)</h2><p>Co-creator and star Ricky Gervais' Hollywood satire, <em>Extras</em>, boasted a gut-busting rotation of celebrity guest stars playing the most ridiculously antithetical versions of themselves, one of the most memorable being Kate Winslet. Years before she took home an Academy Award for <em>The Reader</em>, the English actor appeared in an episode in which she openly obsesses over finding the role that will win her an Oscar.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="fr5poFiuoQoDiBLYxzFSUT" name="3-curb-palestinian-chicken-id_411c2a54-b2ba-469f-8cae-1cfbba4a5584.jpeg" alt="Larry indecisive in Curb Your Enthusiasm" src="https://cdn.mos.cms.futurecdn.net/fr5poFiuoQoDiBLYxzFSUT.jpeg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: HBO)</span></figcaption></figure><h2 id="larry-david-curb-your-enthusiasm">Larry David (Curb Your Enthusiasm)</h2><p><a href="https://www.cinemablend.com/television/1703049/seinfeld-the-cast-then-and-now"><em>Seinfeld</em> cast</a> member Jason Alexander eventually realized that his hopelessly neurotic character, George Costanza, was the fictional alter ego of co-creator Larry David. However, none of George's self-destructive and alienating flaws on the <a href="https://www.cinemablend.com/television/100-best-tv-sitcoms-of-all-time-ranked">beloved TV sitcom</a> could compare to David's self-parodic portrayal of himself on <em>Curb Your Enthusiasm</em>, on which the comedian would seemingly go out of his way to offend friends, family members, and just about anyone he came into contact with.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="5mhuYYiJshYEtA39AwFfiP" name="bill murray.jpg" alt="Bill Murray in Zombieland" src="https://cdn.mos.cms.futurecdn.net/5mhuYYiJshYEtA39AwFfiP.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Sony)</span></figcaption></figure><h2 id="bill-murray-zombieland">Bill Murray (Zombieland)</h2><p>Out of all the amazing, <a href="https://www.cinemablend.com/news/2493232/the-7-best-random-bill-murray-movie-and-tv-cameos">random Bill Murray cameos</a> to choose from, the most iconic would have to be his appearance in 2009's <em>Zombieland</em> when our four protagonists (Woody Harrelson, Jesse Eisenberg, Emma Stone, and Abigail Breslin) stumble upon him while taking refuge in his mansion. It is actually not too much of a stretch to believe that this is how the comedy legend might live during the zombie apocalypse, from dressing himself up as one of the undead to blend in, to citing <em>Garfield</em> as his one regret before succumbing to an accidental shotgun blast.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="hi2cN5FxW6HV9LzZx9gXb6" name="Barker Happy Gilmore.jpg" alt="Bob Barker and Adam Sandler in Happy Gilmore" src="https://cdn.mos.cms.futurecdn.net/hi2cN5FxW6HV9LzZx9gXb6.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Universal Pictures)</span></figcaption></figure><h2 id="bob-barker-happy-gilmore">Bob Barker (Happy Gilmore)</h2><p>After decades of maintaining a sunny demeanor as the host of <em> The Price is Right</em>, it was shocking to see Bob Barker appear as anything but in his iconic cameo in 1995's <em>Happy Gilmore</em>. Adam Sandler's title character gets fed up with Barker's incessant criticism of his golfing skills, driving him to show him that "the price is wrong," only to discover that the older man has some real fight in him.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="2CpyUn6XS8jgR2rDhMEZv9" name="simpsonshawking" alt="Stephen Hawking on The Simpsons" src="https://cdn.mos.cms.futurecdn.net/2CpyUn6XS8jgR2rDhMEZv9.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Fox)</span></figcaption></figure><h2 id="stephen-hawking-the-simpsons">Stephen Hawking (The Simpsons)</h2><p>Influential theoretical physicist Stephen Hawking <a href="https://www.cinemablend.com/television/celebrities-who-played-themselves-on-the-simpsons">played himself on <em>The Simpsons</em></a> on multiple occasions. One of the funnier instances comes from the Season 10 episode, "They Saved Lisa's Brain," in which he clocks Seymour Skinner in the face with a spring-loaded boxing glove built into his wheelchair.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="YhqggHHJZ2JAdqcLgN9uCH" name="prince niew girl" alt="Jess and Nick fangirling over Prince in New Girl" src="https://cdn.mos.cms.futurecdn.net/YhqggHHJZ2JAdqcLgN9uCH.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: FOX)</span></figcaption></figure><h2 id="prince-new-girl">Prince (New Girl)</h2><p>As <em>New Girl</em> creator Liz Meriwether recalled in an article for Vulture (via <a href="https://slate.com/culture/2016/04/new-girls-creator-recalls-when-prince-was-her-guest-star-and-creative-partner.html">Slate</a>), Prince loved the quirky sitcom, which is why he agreed to guest star in an episode that, essentially, portrays him as some sort of mysterious magical guide. Quite frankly, it is hard to think of this portrayal as much of an exaggeration from the late, great pop star's true, legendary persona.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="m3BHZbdt8GyWY5CTAAzCwV" name="spongebobhoff3" alt="David Hasselhoff cruising through the water in The SpongeBob Squarepants Movie" src="https://cdn.mos.cms.futurecdn.net/m3BHZbdt8GyWY5CTAAzCwV.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Paramount / Nickelodeon)</span></figcaption></figure><h2 id="david-hasselhoff-the-spongebob-squarepants-movie">David Hasselhoff (The Spongebob Squarepants Movie)</h2><p>Even though most young audience members seeing <em>The SpongeBob Squarepants Movie</em> in 2004 likely were not familiar with David Hasselhoff, it still makes perfect sense that the former <em>Baywatch</em> star would come to SpongeBob (Tom Kenny) and Patrick's (Bill Fagerbakke) rescue near the end. The actor uses his body as a motorboat to transport the duo back to Bikini Bottom, which was achieved in part with the use of a <a href="https://www.cinemablend.com/movies/funny-story-behind-the-spongebob-squarepants-movie-david-hasselhoff-cameo-13-foot-statue-of-him">frighteningly realistic, double-sized replica</a>, which he later brought home with him.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="93TP5ryazNJabQh9Hjohae" name="zachgalifianakisferns" alt="Zach Galifianakis in Between Two Ferns: The Movie" src="https://cdn.mos.cms.futurecdn.net/93TP5ryazNJabQh9Hjohae.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="zach-galifianakis-between-two-ferns">Zach Galifianakis (Between Two Ferns)</h2><p>Zach Galifianakis has a great reputation as a wonderful talk show guest, despite his alter ego on <em>Between Two Ferns</em> being an absolute disaster as a talk show host. After years of mercilessly roasting celebrities to their faces on Funny or Die's web series, it inspired a mockumentary-style Netflix original movie in which the <em>Hangover</em> star also got to be the butt of the joke.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="UW2CpumX6rwSkbCtSHk2nA" name="haroldkumarnph2" alt="John Cho, Kal Penn, and Neil Patrick Harris in Harold & Kumar Go to White Castle" src="https://cdn.mos.cms.futurecdn.net/UW2CpumX6rwSkbCtSHk2nA.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Warner Bros.)</span></figcaption></figure><h2 id="neil-patrick-harris-harold-kumar-go-to-white-castle">Neil Patrick Harris (Harold & Kumar Go To White Castle)</h2><p>You might as well call Neil Patrick Harris' performance in <em>Harold & Kumar Go to White Castle</em> his audition to play Barney Stinson, considering his highly fictionalized alter ego has much more in common with his role in the <a href="https://www.cinemablend.com/television/2474932/how-i-met-your-mother-whats-the-cast-up-to-now"><em>How I Met Your Mother</em> cast</a>. The Emmy winner goes further with the uproarious portrayal in the sequels, which reveal the actor is only pretending to be gay to better his career.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="W5arZTs5U8Dg3edB9YDDWT" name="Nic Cage 720.jpg" alt="Nicolas Cage as Nicolas Cage in The Unbearable Weight of Massive Talent" src="https://cdn.mos.cms.futurecdn.net/W5arZTs5U8Dg3edB9YDDWT.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Lionsgate)</span></figcaption></figure><h2 id="nicolas-cage-the-unbearable-weight-of-massive-talent">Nicolas Cage (The Unbearable Weight Of Massive Talent)</h2><p>I can understand why <a href="https://www.cinemablend.com/movies/nicolas-cage-reveals-how-he-was-convinced-to-play-himself-in-the-unbearable-weight-of-massive-talent">Nicolas Cage was initially reluctant to play himself</a> in <em>The Unbearable Weight of Massive Talent</em>, especially for the pretty far-out ways the Academy Award winner pokes fun at himself and his unique career in the film. Then again, it does paint him in a largely positive light and even allows him to be the hero of its irreverent, comedic action plot in the end.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="ShXS3GJnMyEZ6Zmk6a4wWH" name="zoolanderdavidbowie" alt="David Bowie in Zoolander" src="https://cdn.mos.cms.futurecdn.net/ShXS3GJnMyEZ6Zmk6a4wWH.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Paramount)</span></figcaption></figure><h2 id="david-bowie-zoolander">David Bowie (Zoolander)</h2><p>Admittedly, David Bowie's cameo in <em>Zoolander</em> is relatively tame when compared to his out-of-this-world stage presence. However, the idea of the rock 'n roll legend randomly appearing out of nowhere to help judge an impromptu "Walk Off" between Ben Stiller's eponymous male model and his rival, Hansel (Owen Wilson), is still pretty ridiculous.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="xAreDfknSR5FH8U9Lwyv5G" name="Jury Duty Feel-Good-2.jpg" alt="James Marsden in Jury Duty" src="https://cdn.mos.cms.futurecdn.net/xAreDfknSR5FH8U9Lwyv5G.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Freevee)</span></figcaption></figure><h2 id="james-marsden-jury-duty">James Marsden (Jury Duty)</h2><p>It takes a special kind of performance as one's self to receive an Emmy nomination for it, and that is what James Marsden achieved with <em>Jury Duty</em>. In the Amazon Prime original reality show, a gentleman named Ronald Gladden is called into serve on a trial he does not know is an elaborate prank on him, involving a cast of actors that includes the <em>X-Men</em> and <em>Sonic the Hedgehog</em> actor as a more vain portrait of himself.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="7rGCWDa6Zta9HutKycCEnT" name="debramessingbros" alt="Debra Messing in Bros" src="https://cdn.mos.cms.futurecdn.net/7rGCWDa6Zta9HutKycCEnT.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Universal)</span></figcaption></figure><h2 id="debra-messing-bros">Debra Messing (Bros)</h2><p><em>Will & Grace</em> star Debra Messing poked fun at her status as an icon in the gay community with her cameo in the LGBTQIA+ rom-com, <em>Bros</em>. The Emmy winner feels compelled to remind Bobby (Billy Eichner) that she is "NOT GRACE" when he asks her for romantic advice when all she wanted to do was tour his museum.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="8E6Czends4D3n3icCoCVTH" name="keanu reeves.jpg" alt="Keanu Reeves in Always Be My Maybe" src="https://cdn.mos.cms.futurecdn.net/8E6Czends4D3n3icCoCVTH.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="keanu-reeves-always-be-my-maybe">Keanu Reeves (Always Be My Maybe)</h2><p>In addition to leading <a href="https://www.cinemablend.com/news/2565790/the-best-action-movies-and-how-to-watch-them">classic action movies</a> like <em>Speed</em> and <em>John Wick</em>, <a href="https://www.cinemablend.com/news/2492927/the-best-random-keanu-reeves-appearances-in-movies">Keanu Reeves has become a cameo king</a> with funny, random appearances, such as in Netflix's 2019 comedy <em>Always Be My Maybe</em>. Marcus (Randall Park) is shocked to discover that his childhood friend, Sasha's (Ali Wong), new boyfriend is the actor, who <a href="https://www.cinemablend.com/news/2474255/ali-wong-reveals-the-scenes-keanu-reeves-improvised-for-netflixs-always-be-my-maybe">partially improvised his portrayal</a> as a pretentious weirdo who wears glasses without lenses and asks for a meal inspired by "the concept of time" at a restaurant.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="cRB3Nh8nYAghwtE8eowd79" name="malkovich_hed (1).jpg" alt="John Malkovich in Being John Malkovich." src="https://cdn.mos.cms.futurecdn.net/cRB3Nh8nYAghwtE8eowd79.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Universal Pictures)</span></figcaption></figure><h2 id="john-malkovich-being-john-malkovich">John Malkovich (Being John Malkovich)</h2><p>John Malkovich's performance in director Spike Jonze's inventive fantasy comedy, <em>Being John Malkovich</em>, is a special case of an actor playing an exaggerated version of himself because he is technically playing multiple roles. One famous scene sees the two-time Oscar nominee entering a portal that leads to his own mind, but places him in a nightmarish world filled with people who have his face and can only speak his last name.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="m6psFXQdzBcJU5fC5riTjS" name="LeBron James - Trainwreck.jpg" alt="Lebron James in Trainwreck" src="https://cdn.mos.cms.futurecdn.net/m6psFXQdzBcJU5fC5riTjS.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Universal Pictures)</span></figcaption></figure><h2 id="lebron-james-trainwreck">LeBron James (Trainwreck)</h2><p>LeBron James has made a decent living outside of his professional basketball career by playing fictionalized versions of himself in the likes of <em>Space Jam: A New Legacy</em> and the 2023 <em>House Party</em> remake. However, the movie that started it all was 2015's <em>Trainwreck</em>, which portrays him as the best friend of a doctor (played by Bill Hader) who specializes in treating star athletes.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="DE29NgixUnJpVtrrb4tGAA" name="maxresdefault - 2022-09-02T081136.172.jpg" alt="Olivia Newton-John and Jane Lynch in Glee." src="https://cdn.mos.cms.futurecdn.net/DE29NgixUnJpVtrrb4tGAA.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Fox)</span></figcaption></figure><h2 id="olivia-newton-john-glee">Olivia Newton-John (Glee)</h2><p>One of the most <a href="https://www.cinemablend.com/television/glee-the-top-guest-appearances-on-the-show-we-cant-stop-thinking-about">memorable guest appearances on <em>Glee</em></a> was the late Olivia Newton-John. The <em>Grease</em> star showed up on the coming-of-age musical-dramedy a couple of times, in which she is portrayed as extremely rude and "hopelessly devoted" to herself.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="TVjXYYnwT8swDADWERPKEk" name="bruce.jpg" alt="Bruce Campbell in My Name Is Bruce" src="https://cdn.mos.cms.futurecdn.net/TVjXYYnwT8swDADWERPKEk.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Image Entertainment)</span></figcaption></figure><h2 id="bruce-campbell-my-name-is-bruce">Bruce Campbell (My Name Is Bruce)</h2><p>No matter what role he plays, it is hard to see Bruce Campbell as anything other than the hero of the <a href="https://www.cinemablend.com/streaming-news/the-evil-dead-movies-streaming"><em>Evil Dead</em> movies</a>, Ash Williams. The Scream King leans into that reputation in the 2007 <a href="https://www.cinemablend.com/news/2487923/ready-or-not-and-the-best-horror-comedy-movies-ever">horror-comedy movie</a>, <em>My Name Is Bruce</em> (which he also directs), as a hard-drinking, washed-up version of himself who becomes the last hope to save a small Oregon town from a malevolent demon.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="Zd5pHaGnV5V52X6Em9WbGN" name="jessicabielbojack" alt="Jessica Biel in BoJack Horseman" src="https://cdn.mos.cms.futurecdn.net/Zd5pHaGnV5V52X6Em9WbGN.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="jessica-biel-bojack-horseman">Jessica Biel (BoJack Horseman)</h2><p>Netflix's animated Hollywood satire, <em>BoJack Horseman</em>, is especially famous for its uproarious celebrity cameos, one of the funniest being Jessica Biel. Not only does the former <em>7th Heaven</em> cast member boldly call out her own career low points, but is also portrayed as the spouse of Mr. Peanutbutter (Paul F. Tompkins), whom she leaves for her real-life husband, Justin Timberlake.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="cd6GpUYzSKhuagYKpyf2qM" name="intervieweminem" alt="Eminem interviewed by David Skylark in The Interview" src="https://cdn.mos.cms.futurecdn.net/cd6GpUYzSKhuagYKpyf2qM.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Sony)</span></figcaption></figure><h2 id="eminem-the-interview">Eminem (The Interview)</h2><p>Earlier in his career, Eminem was criticized for lyrics that were interpreted as homophobic, which he pokes fun at in a hilarious way in Seth Rogen and Evan Goldberg's <em>The Interview</em>. Arguably the funniest scene in the 2014 comedy sees the Grammy-winning rap artist speaking to talk show host Dave Skylark (James Franco), to whom he very nonchalantly reveals that he is a closeted gay man.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="6XvCzYtiZMfoawZNDWNB75" name="broadcitykellyripa" alt="Kelly Ripa on Broad City" src="https://cdn.mos.cms.futurecdn.net/6XvCzYtiZMfoawZNDWNB75.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Comedy Central)</span></figcaption></figure><h2 id="kelly-ripa-broad-city">Kelly Ripa (Broad City)</h2><p>TV personality Kelly Ripa brilliantly mocks her clean image with her cameo on Comedy Central's <em>Broad City</em>. During a visit to the beloved daytime talk show host's apartment, Abbi (co-creator Abbi Jacobson) discovers that she can be a pretty hard partier, especially when cracks open a jar of moonshine.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="RpjW4E6fCY6WqWarXbrGiH" name="ryanfamilyguy" alt="Ryan Reynolds and Peter Griffin on Family Guy" src="https://cdn.mos.cms.futurecdn.net/RpjW4E6fCY6WqWarXbrGiH.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Fox)</span></figcaption></figure><h2 id="ryan-reynolds-family-guy">Ryan Reynolds (Family Guy)</h2><p>Many celebrities have stopped by to voice appropriately <em>cartoonish</em> versions of themselves on <em>Family Guy</em>, including Ryan Reynolds, who clearly had a lot of fun with his guest spot. He moves in across the street from the Griffins and appears to take an intense liking to Peter (Seth MacFarlane), who begins to suspect that the actor has a crush on him.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="gnqHVsQa2sEuEptDxTxkyK" name="cherwillandgrace" alt="Cher on Will & Grace" src="https://cdn.mos.cms.futurecdn.net/gnqHVsQa2sEuEptDxTxkyK.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="cher-will-grace">Cher (Will & Grace)</h2><p>In Season 3 of <em>Will & Grace</em>, Jack (Sean Hayes) becomes uncomfortably attached to a doll modeled after Cher, treating it as if it were the real multi-talented icon, much to the chagrin of his friends. When the real Cher appears to voice her concerns about his obsession, Jack mistakes her for a very convincing drag queen.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="AdxBVEyAsVi3gCSDybE2VT" name="arresteddevelopmentcarl" alt="Carl Weathers on Arrested Development" src="https://cdn.mos.cms.futurecdn.net/AdxBVEyAsVi3gCSDybE2VT.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Fox)</span></figcaption></figure><h2 id="carl-weathers-arrested-development">Carl Weathers (Arrested Development)</h2><p>Some of <em>Arrested Development</em>'s remarkably clever meta humor involved hilarious cameos by celebrities as themselves, most notably Carl Weathers. The <em>Rocky</em> and <em>Predator</em> star's appearances on the cult favorite sitcom saw him dropping clues of being extremely thrifty, to the point that he would save the meat on a mostly eaten rib to make stew.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="5Rjd2fcD85CPnnNsr4PBiZ" name="studio 666.jpg" alt="Dave Grohl in Studio 666" src="https://cdn.mos.cms.futurecdn.net/5Rjd2fcD85CPnnNsr4PBiZ.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Open Road Films)</span></figcaption></figure><h2 id="dave-grohl-studio-666">Dave Grohl (Studio 666)</h2><p>Each member of Foo Fighters willfully takes aim at themselves in the 2022 <a href="https://www.cinemablend.com/streaming-news/great-musical-horror-comedy-movies-and-where-to-find-them">musical horror-comedy movie</a>, <em>Studio 666</em>, but frontman Dave Grohl especially goes wild here. He becomes a threat to his bandmates after becoming possessed by a spirit that haunts the California house where they choose to record their tenth album.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="yBscSVFR7LstotKx2JU9xV" name="episodes" alt="Matt LeBlanc on Episodes." src="https://cdn.mos.cms.futurecdn.net/yBscSVFR7LstotKx2JU9xV.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Showtime)</span></figcaption></figure><h2 id="matt-leblanc-episodes">Matt LeBlanc (Episodes)</h2><p>One of Matt LeBlanc's most successful gigs after leaving the <a href="https://www.cinemablend.com/television/2474356/what-have-the-friends-cast-been-up-to-since-the-show-ended"><em>Friends</em> cast</a> was playing a very personal role on Showtime's <em>Episodes</em>. The actor earned a Golden Globe for portraying himself as likable but overbearing, as the married creators of a new TV show that he is cast in discover.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="pFrjnZbGo6Hy9asAs86wD6" name="shaunwhitefriendswithbenefits" alt="Shaun White in Friends with Benefits" src="https://cdn.mos.cms.futurecdn.net/pFrjnZbGo6Hy9asAs86wD6.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Sony)</span></figcaption></figure><h2 id="shaun-white-friends-with-benefits">Shaun White (Friends With Benefits)</h2><p>Olympic Gold Medal-winning snowboarder Shaun White seems like a fun, down-to-earth dude, which makes his cameo in <em>Friends with Benefits</em> as anything but that so memorably funny. Because of his interest in Jamie (Mila Kunis), White takes an immediate and very intense dislike toward her platonic, occasional lover, Dylan (Justin Timberlake), threatening him at every turn.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="5NpYAL5LzD5CjY7RzxrpvN" name="LA.jpg" alt="Don't Trust The B----'s James Van Der Beek left Hollywood" src="https://cdn.mos.cms.futurecdn.net/5NpYAL5LzD5CjY7RzxrpvN.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><h2 id="james-van-der-beek-don-t-trust-the-b-in-apartment-23">James Van Der Beek (Don’t Trust The B– in Apartment 23)</h2><p>James Van Der Beek's first major return to TV after leading the <a href="https://www.cinemablend.com/television/2554418/what-the-cast-of-dawsons-creek-is-doing-now"><em>Dawson’s Creek</em> cast</a> was a main role on <em>Don’t Trust the B</em>–<em> in Apartment 23 </em>as... James Van Der Beek. The actor's absurd portrayal of the famous best friend to Krysten Ritter’s Chloe is miles away from his true self, but it did somehow predict that he would later appear on <em>Dancing with the Stars</em>.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="4bZ7d8EsuW68KW8bLxZZjS" name="ryanseacrestknockedup" alt="Ryan Seacrest in Knocked Up" src="https://cdn.mos.cms.futurecdn.net/4bZ7d8EsuW68KW8bLxZZjS.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Universal)</span></figcaption></figure><h2 id="ryan-seacrest-knocked-up">Ryan Seacrest (Knocked Up)</h2><p>The <a href="https://www.cinemablend.com/television/a-timeline-of-ryan-seacrests-biggest-hosting-gigs">timeline of Ryan Seacrest's hosting gigs</a> is so prolific and extensive, he is almost (if not more) famous than many of the people he has interviewed over the years. He acknowledges this in his cameo in <em>Knocked Up</em>, in which the then-<em>E! News</em> presenter portrays himself as comically vain, ill-tempered, and foul-mouthed, which are not good qualities on camera.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="LEYXvCXAMRnViL46wJVdmT" name="livingwithyourselftombrady" alt="Tom Brady on Living with Yourself" src="https://cdn.mos.cms.futurecdn.net/LEYXvCXAMRnViL46wJVdmT.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="tom-brady-living-with-yourself">Tom Brady (Living With Yourself)</h2><p>The Netflix sci-fi comedy series, <em>Living with Yourself</em>, stars Paul Rudd as Miles Elliott, who discovers that a life-changing wellness spa has cloned him into a better version of himself when he comes face-to-face with his "flawed" double. In the first episode, Miles sees the New England Patriots quarterback walking out of the spa before revealing he has visited it six previous times, which also <em>happened</em> to be his number of Super Bowl wins at the time.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="EshsZomWHJA3jDSSmkPgc9" name="pacinojackandjill" alt="Al Pacino in a Jack and Jill starring in a Dunkin Donuts commercial" src="https://cdn.mos.cms.futurecdn.net/EshsZomWHJA3jDSSmkPgc9.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Sony Pictures)</span></figcaption></figure><h2 id="al-pacino-jack-and-jill">Al Pacino (Jack And Jill)</h2><p>If there is one good thing about 2011's <em>Jack and Jill</em>, which stars Adam Sandler as both a family man and his obnoxious twin sister, it is Al Pacino's performance as himself. In the comedy, the Oscar winner expresses affection for Jill, which leads him to star in a "Dunkaccino" ad that he believes should be destroyed moments after watching it.</p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ 32 Movies And TV Shows That Make Comedy Out Of Dark Situations ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/movies/movies-tv-shows-that-make-comedy-out-of-dark-situations</link>
                                                                            <description>
                            <![CDATA[ Ha ha... huh. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">ENoNJoKwyKDZY8hJsgUhYb</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/KJPKuJuCNBSQPDeq2n4ujT-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Thu, 24 Apr 2025 13:30:00 +0000</pubDate>                                                                                                                                                                                                                                <category><![CDATA[Movies]]></category>
                                                                                                                    <dc:creator><![CDATA[ Jason Wiese ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/62SRu9Bi2SyJGrpzKXAfsK.jpg ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Jason Wiese writes feature stories for CinemaBlend. His occupation results from years dreaming of a filmmaking career, settling on a &quot;professional film fan&quot; career, studying journalism at Lindenwood University in St. Charles, MO (where he served as Culture Editor for its student-run print and online publications), and a brief stint of reviewing movies for fun. He would later continue that side-hustle of film criticism on TikTok (@wiesewisdom), where he posts videos on a semi-weekly basis.&lt;/p&gt;&lt;p&gt;&lt;br&gt;&lt;/p&gt;&lt;p&gt;Jason has been writing since he was able to pick up a washable marker, with which he wrote his debut illustrated children&#039;s story, later transitioning to a short-lived comic book series and (very) amateur filmmaking before finally settling on pursuing a career in writing about movies in lieu of making them. Look for his name in almost any article about Batman.&lt;/p&gt;&lt;p&gt;&lt;br&gt;&lt;/p&gt;&lt;p&gt;&lt;strong&gt;What He&#039;s Into&lt;/strong&gt;: Readers may notice a recurring theme of horror and superhero-related content (especially in regards to Batman) in much of Jason&#039;s work, but his favorite film of all time is more in line with traditional action/adventure stories: &lt;em&gt;Raiders of the Lost Ark&lt;/em&gt;. His favorite TV series is the gritty, grounded crime thriller &lt;em&gt;Breaking Bad&lt;/em&gt; and if you catching him reading anything, it is probably a comic book (and, more often than not, one featuring Batman). More important to him than entertainment, however, are his wife and two dogs.&lt;/p&gt;&lt;p&gt;&lt;br&gt;&lt;/p&gt;&lt;p&gt;&lt;strong&gt;What He&#039;s Excited About Right Now&lt;/strong&gt;: Jason typically tries to keep his excitement and expectations for any upcoming movies as low as possible, but he is certainly looking forward to returning to Matt Reeves&#039; vision of Gotham City in the upcoming follow-up to &lt;em&gt;The Batman&lt;/em&gt; and just about any horror movie set to haunt cinemas soon.&lt;/p&gt; ]]></dc:description>
                                                                                                                                <cf:isSponsored>false</cf:isSponsored>
                <cf:hasAffiliateLinks>false</cf:hasAffiliateLinks>
                <cf:isPaid>false</cf:isPaid>
                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/KJPKuJuCNBSQPDeq2n4ujT-1280-80.jpg">
                                                            <media:credit><![CDATA[Gramercy Pictures]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[Frances McDormand in Fargo]]></media:description>                                                            <media:text><![CDATA[Frances McDormand in Fargo]]></media:text>
                                <media:title type="plain"><![CDATA[Frances McDormand in Fargo]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/KJPKuJuCNBSQPDeq2n4ujT-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>There is a famous saying that claims, “Comedy is tragedy plus time,” and it appears that some artists like to put an extra emphasis on the more tragic element of that equation. Some of the all-time funniest movies and <a href="https://www.cinemablend.com/television/100-best-tv-sitcoms-of-all-time-ranked">best TV sitcoms</a> boast a plot that would normally be found in a serious drama if it were not for their more absurd or quirky tones. Hopefully, you have never felt too guilty for laughing at any of these darkly humorous classics of the big and small screen.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="N9eiDthz5feLkZvsKpFmDA" name="Dr. Strangelove.jpg" alt="Peter Sellers in Dr. Strangelove" src="https://cdn.mos.cms.futurecdn.net/N9eiDthz5feLkZvsKpFmDA.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Columbia Pictures)</span></figcaption></figure><h2 id="dr-strangelove-or-how-i-learned-to-stop-worrying-and-love-the-bomb-1964">Dr. Strangelove Or: How I Learned To Stop Worrying And Love The Bomb (1964)</h2><p>A <a href="https://www.cinemablend.com/news/2487680/the-10-best-stanley-kubrick-movies-ranked">film by Stanley Kubrick</a> about a group of politicians and military personnel desperately struggling to find a solution to an imminent nuclear catastrophe sounds like an intense thriller. In truth, <em>Dr. Strangelove or: How I Learned to Stop Worrying and Love the Bomb</em>, based on author Peter George's <em>Red Alert</em>, is a blistering, gut-busting satire, brilliantly led by Peter Sellers in three distinct roles.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="AgAMVAiqCt5MRoEsLWuce6" name="3819764744f630decbc8fef5ea527a5821e522d827f79c5289ade3be92ab54fa (1).jpg" alt="Bill Hader in Barry." src="https://cdn.mos.cms.futurecdn.net/AgAMVAiqCt5MRoEsLWuce6.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: HBO)</span></figcaption></figure><h2 id="barry-2018-2023">Barry (2018–2023)</h2><p>Just about the <a href="https://www.cinemablend.com/television/the-best-thing-these-great-snl-actors-have-starred-in-outside-of-the-show">best thing starring former <em>Saturday Night Live</em> actor</a> Bill Hader, which he also co-created with Alec Berg, is <em>Barry</em>, which follows a hitman struggling to put his past behind him when he takes up an interest in acting. The HBO series starts off as a clever comedy with effective moments of intense drama before slowly evolving into an intense drama with moments of clever comedy.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="rJ8vtpv4y5er4rG9gQu7wW" name="the-hangover.jpeg" alt="Zach Galifianakis, Bradley Cooper and Ed Helms in The Hangover" src="https://cdn.mos.cms.futurecdn.net/rJ8vtpv4y5er4rG9gQu7wW.jpeg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Warner Bros)</span></figcaption></figure><h2 id="the-hangover-2009">The Hangover (2009)</h2><p>Most films <a href="https://www.cinemablend.com/movies/great-movies-that-take-place-in-las-vegas-and-how-to-watch-them">set in Las Vegas</a>, no matter the genre, fixate on the more glamorous aspects of the Entertainment Capital of the World, but not <em>The Hangover</em>. As seen through the eyes of three groomsmen (played by Bradley Cooper, Ed Helms, and Zach Galifianakis) desperate to find the groom (played by Justin Bartha) after a bachelor party they can't remember, Todd Phillips' hilariously unhinged blockbuster boldly embraces the "sin" in Sin City.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="4xne2rtog8WPwcJxomGqaS" name="beeeeef copy.jpg" alt="Ali Wong and Steven Yeun in Beef" src="https://cdn.mos.cms.futurecdn.net/4xne2rtog8WPwcJxomGqaS.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="beef-2023">Beef (2023)</h2><p>Road rage is already nothing to joke about, but even an incident that small can evolve into a conflict of uproariously disastrous proportions. This is demonstrated brilliantly in Netflix's Emmy-winning <a href="https://www.cinemablend.com/television/best-a24-tv-shows-and-specials">A24-produced TV show</a>, <em>Beef</em>, starring Steven Yeun and Ali Wong as two sides of a feud that slowly spirals out of control.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="U4w627yLHcdyK2yEqdjVGf" name="After Hours - Griffin Dunne stands with a look of exasperation" alt="Griffin Dunne stands with a look of exasperation in After Hours." src="https://cdn.mos.cms.futurecdn.net/U4w627yLHcdyK2yEqdjVGf.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Warner Bros.)</span></figcaption></figure><h2 id="after-hours-1985">After Hours (1985)</h2><p>Martin Scorsese is most definitely not a filmmaker who is commonly associated with comedy, but he has a few funny flicks on his resume, such as <em>After Hours</em>. The relatively <a href="https://www.cinemablend.com/movies/classic-80s-movies-youve-probably-forgotten-about">overlooked '80s movie</a>, in which an unassuming New Yorker (played by Griffin Dunne) becomes embroiled in a series of dangerous situations over the course of one night, actually does sound like an on-brand effort for the <em>Goodfellas</em> director based purely on its plot description.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="wWYZmVt2NBGBw9Yafomxtd" name="bojack-horseman-season-5-1569610502396.png" alt="BoJack in BoJack Horseman" src="https://cdn.mos.cms.futurecdn.net/wWYZmVt2NBGBw9Yafomxtd.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="bojack-horseman-2014-2020">BoJack Horseman (2014–2020)</h2><p><em>BoJack Horseman</em> is one of Netflix's darkest original series, depicting the life of a self-destructive, narcissistic, washed-up actor and the negative effect he has on the people he encounters. The series might not be as funny if it were not animated and the title character (voiced by Will Arnett) was not an anthropomorphic horse.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="2HEk4ScwzixRuXMxXMxEFU" name="Untitled-6.jpg" alt="Bruce Campbell in Evil Dead II" src="https://cdn.mos.cms.futurecdn.net/2HEk4ScwzixRuXMxXMxEFU.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Renaissance Pictures)</span></figcaption></figure><h2 id="evil-dead-ii-1987">Evil Dead II (1987)</h2><p>Even on a shoestring budget, writer and director Sam Raimi achieved "the ultimate experience in grueling terror" with the first installment of his <a href="https://www.cinemablend.com/streaming-news/the-evil-dead-movies-streaming"><em>Evil Dead</em> movies</a>. However, the second chapter, following Ash Williams (Bruce Campbell) and his fight against possessive spirits, is one of cinema's most perfect blends of horror with comedy of a most nonsensically cartoonish degree.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="LEGjLGsAvyLyrbYfzbfTDH" name="mortyandrick.jpg" alt="Rick and Morty poppin champagne" src="https://cdn.mos.cms.futurecdn.net/LEGjLGsAvyLyrbYfzbfTDH.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Adult Swim)</span></figcaption></figure><h2 id="rick-and-morty-2013-present">Rick And Morty (2013–present)</h2><p>The fate of the world, and even other worlds, often rests in the hands of the titular duo from <em>Rick and Morty</em>: an alcoholic scientist and his anxious teenage grandson. In fact, even some of the bizarre situations they find themselves in, while undeniably threatening, are pretty ridiculous, such as when an alien race challenged Earth to an intergalactic singing competition in one of the <a href="https://www.cinemablend.com/television/2486482/10-best-rick-and-morty-episodes-ranked">best <em>Rick and Morty</em> episodes</a>, "Get Schwifty."</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="gpJ3z5zcVDzVXwVc6bZfCX" name="tbd.jpg" alt="Colin Farrell in In Bruges" src="https://cdn.mos.cms.futurecdn.net/gpJ3z5zcVDzVXwVc6bZfCX.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Focus Features)</span></figcaption></figure><h2 id="in-bruges-2008">In Bruges (2008)</h2><p><em>In Bruges</em> stars Colin Farrell and Brendan Gleeson as two Irish hitmen who are forced to take a holiday in a mundane Belgian vacation spot after a job goes horribly wrong. Only a storyteller with a sense of humor as bleak as writer and director Martin McDonagh could construct such a witty romp out of an increasingly dark plot such as this.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="HRiMD3u5mH2z3LiqjH2rnC" name="Fi-T-Top10-Its-Always-Sunny-In-Philadelphia-Moments-720p30.jpg" alt="The main cast of It's Always Sunny in Philadelphia." src="https://cdn.mos.cms.futurecdn.net/HRiMD3u5mH2z3LiqjH2rnC.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: FXX)</span></figcaption></figure><h2 id="it-s-always-sunny-in-philadelphia-2005-present">It's Always Sunny In Philadelphia (2005-Present)</h2><p>Perhaps the most definitive example of cringeworthy comedy on television is FX's <em>It's Always Sunny in Philadelphia</em>. The dim-witted gang of bar owners (played by Charlie Day, Rob McElhenney, Glenn Howerton, Kaitlin Olson, and Danny DeVito) often get themselves into situations that are certainly infantile, but also deeply hazardous.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="9D3XUuH2PQ8CahKv3a9s6" name="Fargo (2).jpg" alt="William H. Macy in Fargo" src="https://cdn.mos.cms.futurecdn.net/9D3XUuH2PQ8CahKv3a9s6.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Gramercy Pictures)</span></figcaption></figure><h2 id="fargo-1996">Fargo (1996)</h2><p>In retrospect, it's a good thing Joel and Ethan Coen's Oscar-winning satirization of midwestern culture, <em>Fargo</em>, is not based on fact, as they claimed, because audiences might feel guilty for laughing at a story of an insurance scheme gone violently awry. Creator Noah Hawley's spin-off series would honor that same tone by telling new, seasonal stories set in similar rural locations and with the same quirky tone.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="gQEik7YAxjh725rQSyrCG6" name="kieran-culkin-matthew-macfadyen-fisher-stevens-nicholas-braun-sarah-snook-dagmara-dominczyk.jpg" alt="Everyone looking at Hugo's phone in Succession" src="https://cdn.mos.cms.futurecdn.net/gQEik7YAxjh725rQSyrCG6.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: HBO)</span></figcaption></figure><h2 id="succession-2018-2023">Succession (2018–2023)</h2><p>Sibling rivalry of even the most immature kind can last long into adulthood. Exhibit A: the Roy Family from HBO's <em>Succession</em>, a wealthy patriarch (played by Brian Cox) suffers a stroke that sparks a war over his corporate empire between his three youngest children.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="64CzoUHawRxfZbpi4qkPpi" name="shadows.jpeg" alt="Taika Waititi, Jemaine Clement and Jonathan Brugh in What We Do In The Shadows" src="https://cdn.mos.cms.futurecdn.net/64CzoUHawRxfZbpi4qkPpi.jpeg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Unison/Paladin)</span></figcaption></figure><h2 id="what-we-do-in-the-shadows-2014">What We Do in the Shadows (2014)</h2><p>The life of a vampire, which involves committing murder to satisfy their insatiable bloodlust, is a horrifying concept. However, the <a href="https://www.cinemablend.com/news/2487923/ready-or-not-and-the-best-horror-comedy-movies-ever">beloved horror-comedy movie</a> <em>What We Do In the Shadows</em> (which begat an equally hilarious spin-off series on FX) offers a documentary-style glimpse into that sort of existence that is somewhat relatable and even charmingly funny.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="AmPzZfQEDnCD2eoxRkEeQF" name="omitb_210_cb_00762rt.jpg" alt="Charles, Oliver and Mabel with shopping bags in Only Murders in the Building" src="https://cdn.mos.cms.futurecdn.net/AmPzZfQEDnCD2eoxRkEeQF.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Hulu)</span></figcaption></figure><h2 id="only-murders-in-the-building-2021-present">Only Murders In The Building (2021-Present)</h2><p>A TV show about two elderly men and a young woman teaming up to produce a podcast documenting their investigations of mysterious deaths that occur in their New York apartment complex does not sound very funny. However, with Steve Martin, Martin Short, and Selena Gomez in the lead roles and scripts boasting a razor-sharp wit, <em>Only Murders in the Building</em> is a comical delight.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="yjk6L7PzuZFaNbMxPjvu8K" name="2581 (1).jpg" alt="Peter Dinklage and Frances McDormand in Three Billboards Outside Ebbing, Missouri." src="https://cdn.mos.cms.futurecdn.net/yjk6L7PzuZFaNbMxPjvu8K.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Fox Searchlight Pictures)</span></figcaption></figure><h2 id="three-billboards-outside-ebbing-missouri-2017">Three Billboards Outside Ebbing, Missouri (2017)</h2><p>Anyone familiar with the work of Martin McDonagh should have been able to expect that <em>Three Billboards Outside Ebbing, Missouri</em> would not hold back on its heartbreaking material. However, the story of a grieving mother (played by Frances McDormand) at odds with local law enforcement regarding her teenage daughter's unsolved murder, creates a light aura of false security early on with its bold use of humor.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="UzisZ9SitgmQeojYeJwwaE" name="200412-killing-eve-cs-1121a (1).jpg" alt="Jodie Comer and Sandra Oh in Killing Eve." src="https://cdn.mos.cms.futurecdn.net/UzisZ9SitgmQeojYeJwwaE.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: BBC America)</span></figcaption></figure><h2 id="killing-eve-2018-2022">Killing Eve (2018–2022)</h2><p>Creator Phoebe Waller-Bridge's <em>Killing Eve</em> is a wildly acclaimed series chronicling the intense cat-and-mouse game between a spy (played by Sandra Oh) and a skilled assassin (played by Jodie Comer). The thriller is renowned for its unique blend of high-wire suspense with absurdism.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="rPe8xK2buDxvnuUhb275Zg" name="deathatatafuneral" alt="Three stars from Death at a Funeral standing over a coffin" src="https://cdn.mos.cms.futurecdn.net/rPe8xK2buDxvnuUhb275Zg.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: SKE)</span></figcaption></figure><h2 id="death-at-a-funeral-2007">Death At A Funeral (2007)</h2><p>In director Frank Oz's English comedy, <em>Death at a Funeral</em>, anything that could go wrong at a gathering for a deceased loved one does go wrong, and then some. Daniel (Matthew McFadyen) deals with issues that include the wrong body being delivered to his childhood home, a guest going berserk after unwittingly taking a hallucinogen, and a stranger (played by Peter Dinklage) appearing to reveal a secret about his father's past.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="wQthynSWkr4WSPpaL6288g" name="636449728850866294-shameless-802-0460.R.jpg" alt="Shameless" src="https://cdn.mos.cms.futurecdn.net/wQthynSWkr4WSPpaL6288g.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Showtime)</span></figcaption></figure><h2 id="shameless-2011-2021">Shameless (2011–2021)</h2><p>One of the <a href="https://www.cinemablend.com/television/times-hollywood-tried-to-adapt-british-shows-and-how-it-worked-out">best American TV shows based on a U.K. series</a> is the hit Showtime original, <em>Shameless</em>. Developed by John Wells, the series follows the Gallaghers – a large family from Chicago facing extreme poverty and other various, debilitating struggles, with little to no help from their patriarch (played by William H. Macy).</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="exP8nW4CAHsZdSHrzTtZRm" name="TM_03934.jpg" alt="Anya Taylor-Joy and Ralph Fiennes speaking in The Menu" src="https://cdn.mos.cms.futurecdn.net/exP8nW4CAHsZdSHrzTtZRm.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Searchlight Pictures)</span></figcaption></figure><h2 id="the-menu-2022">The Menu (2022)</h2><p>At first glance, <em>The Menu</em> seems like the kind of <a href="https://www.cinemablend.com/movies/delicious-food-movies-to-watch-now">delicious food movie</a> that fine dining enthusiasts could get a nice laugh out of. Indeed, director Mark Mylod's acclaimed hit starring Anya Taylor-Joy and Nicholas Hoult is funny, but Ralph Fiennes' Chef Slowik has something planned for his carefully selected guests that proves to be truly "to die for."</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="Vwb7UPeC2PjU3BMW4LyoT" name="WeedsNancy.png" alt="Mary-Louise Parker in Weeds" src="https://cdn.mos.cms.futurecdn.net/Vwb7UPeC2PjU3BMW4LyoT.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Showtime)</span></figcaption></figure><h2 id="weeds-2005-2012">Weeds (2005-2012)</h2><p>Mary Louise Parker received three Emmy nominations for her performance on creator Jenji Kohan's dramedy, <em>Weeds,</em> as a widowed suburban mother who relies on drug dealing to make ends meet. It is easy to understand why Vince Gilligan was accused of ripping off the Showtime original when he proposed the idea for <em>Breaking Bad</em> (which he revealed at the <a href="https://www.youtube.com/watch?v=mehU6bkQbY4">Paley Center for Media</a>), but anyone would agree that this show is much funnier.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.48%;"><img id="XiY7Pu6EprAFnkf3Pdwy2k" name="Beau Is Afraid social roundup.jpg" alt="Joaquin Phoenix in Beau Is Afraid." src="https://cdn.mos.cms.futurecdn.net/XiY7Pu6EprAFnkf3Pdwy2k.jpg" mos="" align="middle" fullscreen="" width="1280" height="723" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: A24)</span></figcaption></figure><h2 id="beau-is-afraid-2023">Beau Is Afraid (2023)</h2><p>Save a few notably fanciful moments (<a href="https://www.cinemablend.com/movies/beau-is-afraid-ending-explained">especially at the end</a>), <em>Beau is Afraid</em> is regarded as a relatively authentic representation of what it is like to live with anxiety. Writer and director Ari Aster – known for his more earnest <a href="https://www.cinemablend.com/movies/the-best-a24-horror-movies-ranked">A24 horror movies</a>, <em>Hereditary</em> and <em>Midsommar</em> – achieves this feeling by exaggerating every inconvenience our eponymous hero (played by Joaquin Phoenix) faces to the most absurd degree.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="QkDpsDvQ7nm9qC2mWsU9QT" name="vince vaughn bad monkey shirt" alt="Vince Vaughn looking concerned in Bad Monkey." src="https://cdn.mos.cms.futurecdn.net/QkDpsDvQ7nm9qC2mWsU9QT.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Apple TV+)</span></figcaption></figure><h2 id="bad-monkey-2024-present">Bad Monkey (2024-Present)</h2><p>How do you make a complex murder mystery funny? Well, for one, Carl Hiaasen's 2013 novel that inspired the <a href="https://www.cinemablend.com/television/2566890/the-best-apple-tv-shows-to-watch-including-ted-lasso">Apple TV+ original series</a>, <em>Bad Monkey</em>, already boasted a satirical tone. However, Vince Vaughn's performance as the hero, sarcastic former detective Andrew Yancy, especially brings the humor to the surface.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="jDU6zSvdS8H4vktkedJ3Hn" name="netflix don't look up" alt="Leonardo DiCaprio and Jennifer Lawrence in Don't Look Up." src="https://cdn.mos.cms.futurecdn.net/jDU6zSvdS8H4vktkedJ3Hn.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="don-t-look-up-2021">Don't Look Up (2021)</h2><p>Former <em>SNL</em> writer and <em>Anchorman</em> director Adam McKay started to gain newfound respect with his humorous approach to more earnest topics in Oscar-winning movies <em>The Big Short</em> and <em>Vice</em>. He would follow those with an even darker satire, <em>Don't Look Up</em>, in which two astronomers (played by Leonardo DiCaprio and Jennifer Lawrence) struggle to warn humanity about Earth's impending doom.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="MFbxEavWcfashxcTeZLh7X" name="https___cdn.cnn.com_cnnnext_dam_assets_220112152651-01-after-life-season-3 (1).jpg" alt="Ricky Gervais in After Life." src="https://cdn.mos.cms.futurecdn.net/MFbxEavWcfashxcTeZLh7X.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="after-life-2019-2022">After Life (2019-2022)</h2><p>Creator Ricky Gervais stars in the Netflix comedy series <em>After Life</em> as a man grieving his wife's death, but does nothing to make the process any easier for him. Tony goes as far as adopting an off-putting, devil-may-care attitude to push away anyone who offers solace or assistance.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="xzhQm4u7ciGgYD3hrdCyjT" name="Death of Stalin History.jpg" alt="A scene from The Death of Stalin" src="https://cdn.mos.cms.futurecdn.net/xzhQm4u7ciGgYD3hrdCyjT.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Gaumont)</span></figcaption></figure><h2 id="the-death-of-stalin-2017">The Death Of Stalin (2017)</h2><p>Some of the <a href="https://www.cinemablend.com/movies/best-movies-about-politics">best movies about politics</a> offer a farcical take on even the darkest days in history. Case in point, Armando Iannucci's star-studded satire, <em>The Death of Stalin</em>, which is a hilarious and surprisingly accurate depiction of the aftermath of the notorious Soviet dictator's demise. Though some liberties are taken with the actual history. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="fLFcMGonQpZqSyBBXLHCKb" name="santaclaritadietdrewbarrymore.jpg" alt="Drew Barrymore on Santa Clarita Diet" src="https://cdn.mos.cms.futurecdn.net/fLFcMGonQpZqSyBBXLHCKb.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="santa-clarita-diet-2017-2019">Santa Clarita Diet (2017-2019)</h2><p>Not every TV show about zombies needs to be as stone-cold serious as <em>The Walking Dead</em>, especially if you change the rules of reanimation, like in <em>Santa Clarita Diet</em>. The <a href="https://www.cinemablend.com/television/2564981/netflix-shows-that-were-cancelled-way-too-soon">unfairly cancelled Netflix original series</a> stars Drew Barrymore and Timothy Olyphant as married real estate agents forced to turn to murder when Barrymore's role mysteriously becomes a walking corpse who thrives on raw human flesh.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="gGuxtKL5zUNWMCcYo82p7k" name="World's Greatest Dad.jpg" alt="Robin Williams in World's Greatest Dad" src="https://cdn.mos.cms.futurecdn.net/gGuxtKL5zUNWMCcYo82p7k.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Magnolia Pictures)</span></figcaption></figure><h2 id="world-s-greatest-dad-2009">World's Greatest Dad (2009)</h2><p>Robin Williams stars in writer and director Bobcat Goldthwait's pitch black comedy, <em>World's Greatest Dad</em>, as dissatisfied teacher Lance, who begins to attract overwhelming attention following the news that his teenage son, Kyle (Daryl Sabara), has taken his own life. However, in truth, the insufferably rude Kyle's death was an accident of embarrassing proportions, which Lance has covered up with a phony suicide note in order to take advantage of the subsequent fame.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="3x6m4R3zBeoSEig6mwmRZU" name="Dead to Me Season 3 Tribute To Friendship-1.jpg" alt="Linda Cardellini and Christina Applegate in Dead to Me" src="https://cdn.mos.cms.futurecdn.net/3x6m4R3zBeoSEig6mwmRZU.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="dead-to-me-2019-2022">Dead To Me (2019–2022)</h2><p>The phrase "misery loves company" serves as the essential hook for creator Liz Feldman's darkly comic Netflix original TV show, <em>Dead To Me</em>. Christina Applegate stars as the recently widowed Jen Harding, who crosses paths with the also grieving Judy Hale (Linda Cardellini). What starts off as the friendly bond that each of them desperately needs son evolves into a complicated grouping that sparks trouble for both.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="ejvqPf8amVTBMBHejBYkvd" name="Burn After Reading Brad Pitt" alt="Brad Pitt eating in Burn After Reading" src="https://cdn.mos.cms.futurecdn.net/ejvqPf8amVTBMBHejBYkvd.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Focus Features)</span></figcaption></figure><h2 id="burn-after-reading-2008">Burn After Reading (2008)</h2><p>One of the Coen Brothers' most overlooked dark comedies is <em>Burn After Reading</em>, which imagines what happens when investigative intelligence crosses paths with a severe lack of intelligence. It follows a pair of gym employees (played by Frances McDormand and Brad Pitt) who find a disc holding classified information left by a retired CIA agent and attempt to profit from the discovery.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="zUU6H2h9BRh3Lad4WgfQwW" name="search-party copy.jpg" alt="Alia Shawkat in Search Party" src="https://cdn.mos.cms.futurecdn.net/zUU6H2h9BRh3Lad4WgfQwW.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: HBO Max)</span></figcaption></figure><h2 id="search-party-2016-2022">Search Party (2016-2022)</h2><p><em>Search Party</em> stars Alia Shawkat as a young woman who decides to take it upon herself to find her missing past acquaintance. Of course, bizarre hijinks ensue, causing it to evolve into a far crazier situation for her and her friends over time.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="e4MhKnoCwaFASxTcHe9tUZ" name="John Cusack Romantic Comedy Lead-9.jpg" alt="John Cusack in Better Off Dead" src="https://cdn.mos.cms.futurecdn.net/e4MhKnoCwaFASxTcHe9tUZ.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Warner Bros.)</span></figcaption></figure><h2 id="better-off-dead-1985">Better Off Dead (1985)</h2><p>One of John Cusack's earliest romantic comedies boasts a premise that would be a challenge to get made in modern times. He stars in the coming-of-age film as a young man who repeatedly tries and fails to take his own life.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="8aYvM2HgDBMTE3mNqBzuPn" name="Ella Purnell, Sweetpea" alt="Ella Purnell sitting on a bus in the trailer for Sweetpea." src="https://cdn.mos.cms.futurecdn.net/8aYvM2HgDBMTE3mNqBzuPn.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Starz)</span></figcaption></figure><h2 id="sweetpea-2024">Sweetpea (2024)</h2><p>Ella Purnell earns laughs and screams leading the Starz original series, <em>Sweetpea</em>, as a lonely young woman who adopts a penchant for murder.</p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ 32 TV Episodes That Put A Supporting Character In The Spotlight ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/tv-episodes-that-put-supporting-character-spotlight</link>
                                                                            <description>
                            <![CDATA[ These episodes took the term "show-stealing" literally. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">hbtuhNsQb2XpT5GohA6Fek</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/SR9KT2yYjhYXf33G8r3gvJ-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Wed, 26 Feb 2025 22:33:00 +0000</pubDate>                                                                                                                                                                                                                                <category><![CDATA[Television]]></category>
                                                                                                                    <dc:creator><![CDATA[ Jason Wiese ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/62SRu9Bi2SyJGrpzKXAfsK.jpg ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Jason Wiese writes feature stories for CinemaBlend. His occupation results from years dreaming of a filmmaking career, settling on a &quot;professional film fan&quot; career, studying journalism at Lindenwood University in St. Charles, MO (where he served as Culture Editor for its student-run print and online publications), and a brief stint of reviewing movies for fun. He would later continue that side-hustle of film criticism on TikTok (@wiesewisdom), where he posts videos on a semi-weekly basis.&lt;/p&gt;&lt;p&gt;&lt;br&gt;&lt;/p&gt;&lt;p&gt;Jason has been writing since he was able to pick up a washable marker, with which he wrote his debut illustrated children&#039;s story, later transitioning to a short-lived comic book series and (very) amateur filmmaking before finally settling on pursuing a career in writing about movies in lieu of making them. Look for his name in almost any article about Batman.&lt;/p&gt;&lt;p&gt;&lt;br&gt;&lt;/p&gt;&lt;p&gt;&lt;strong&gt;What He&#039;s Into&lt;/strong&gt;: Readers may notice a recurring theme of horror and superhero-related content (especially in regards to Batman) in much of Jason&#039;s work, but his favorite film of all time is more in line with traditional action/adventure stories: &lt;em&gt;Raiders of the Lost Ark&lt;/em&gt;. His favorite TV series is the gritty, grounded crime thriller &lt;em&gt;Breaking Bad&lt;/em&gt; and if you catching him reading anything, it is probably a comic book (and, more often than not, one featuring Batman). More important to him than entertainment, however, are his wife and two dogs.&lt;/p&gt;&lt;p&gt;&lt;br&gt;&lt;/p&gt;&lt;p&gt;&lt;strong&gt;What He&#039;s Excited About Right Now&lt;/strong&gt;: Jason typically tries to keep his excitement and expectations for any upcoming movies as low as possible, but he is certainly looking forward to returning to Matt Reeves&#039; vision of Gotham City in the upcoming follow-up to &lt;em&gt;The Batman&lt;/em&gt; and just about any horror movie set to haunt cinemas soon.&lt;/p&gt; ]]></dc:description>
                                                                                                                                <cf:isSponsored>false</cf:isSponsored>
                <cf:hasAffiliateLinks>false</cf:hasAffiliateLinks>
                <cf:isPaid>false</cf:isPaid>
                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/SR9KT2yYjhYXf33G8r3gvJ-1280-80.jpg">
                                                            <media:credit><![CDATA[HBO]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[Frank at piano with Bill in HBO&#039;s The Last of Us]]></media:description>                                                            <media:text><![CDATA[Frank at piano with Bill in HBO&#039;s The Last of Us]]></media:text>
                                <media:title type="plain"><![CDATA[Frank at piano with Bill in HBO&#039;s The Last of Us]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/SR9KT2yYjhYXf33G8r3gvJ-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>With all due respect to some classic central TV show protagonists, there are times when it is a good idea to shift gears a bit and show things from another character’s perspective. This has actually become a relatively common practice as many modern small-screen favorites have given a scene-stealing supporting character (or even a never-before-seen character) the chance to almost completely steal the show for an episode. The following are some of the most revered examples.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="UjebcCrHY5gQHQvVkX7oXf" name="startreaknextgenlowerdecks" alt="The characters from "Lower Decks" on Star Trek: The Next Generation" src="https://cdn.mos.cms.futurecdn.net/UjebcCrHY5gQHQvVkX7oXf.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Paramount)</span></figcaption></figure><h2 id="lower-decks-star-trek-the-next-generation">“Lower Decks” - Star Trek: The Next Generation</h2><p>According to <a href="https://tvtropes.org/pmwiki/pmwiki.php/Main/LowerDeckEpisode">TV Tropes</a>, episodes that put supporting characters in the spotlight are referred to as “lower decks episodes.” The term is borrowed from the title of a <a href="https://www.cinemablend.com/television/2562832/the-best-star-trek-the-next-generation-episodes-ranked">classic episode of <em>Star Trek: The Next Generation</em></a> from Season 7 which focuses on a group of younger characters who are working their way up in the ranks at Starfleet.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="C2BHSDQ6meRKU8bCtuxyhT" name="bettercallsaulfiveo" alt="Jonathan Banks as Mike in Better Call Saul" src="https://cdn.mos.cms.futurecdn.net/C2BHSDQ6meRKU8bCtuxyhT.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: AMC)</span></figcaption></figure><h2 id="five-o-better-call-saul">“Five-O” - Better Call Saul</h2><p>Sometimes a character becomes such a memorable scene-stealer that they earn their own <a href="https://www.cinemablend.com/television/tv-spin-offs-that-were-as-good-or-better-than-the-show-they-came-from">equally great spin-off series</a>, such as when <em>Breaking Bad</em>'s Jimmy "Saul Goodman" McGill (Bob Odenkirk) became the star of the prequel, <em>Better Call Saul</em>. In just its first season, the AMC hit proved that Mike Ehrmantraut (Jonathan Banks) could have led his own series, too, in "Five-O," which peers into his origins as a former Philadelphia police officer.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="kuhXb5Hh5vntDgRxFKLUXV" name="mashfreedman" alt="Allan Arbus as Maj. Sidney Freedman on MASH" src="https://cdn.mos.cms.futurecdn.net/kuhXb5Hh5vntDgRxFKLUXV.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBS)</span></figcaption></figure><h2 id="dear-sigmund-m-a-s-h">“Dear Sigmund” - M.A.S.H.</h2><p>One character from <em>M.A.S.H.</em> whom you could always rely on to give sage advice is Maj. Sidney Freedman (Allan Arbus), who got to the be star in a Season 5 episode called "Dear Sigmund." The Alan Alda-directed episode sees the recurring character penning a letter to legendary psychiatrist Sigmund Freud while visiting the 4077.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="NtugkHhxA35WyUE8msPF44" name="mysocalledlifebrian" alt="Devon Gummersall as Brian Krakow at World Happiness Dance in My So-Called Life" src="https://cdn.mos.cms.futurecdn.net/NtugkHhxA35WyUE8msPF44.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><h2 id="life-of-brian-my-so-called-life">“Life Of Brian” - My So-Called Life</h2><p>A <a href="https://www.cinemablend.com/television/90s-shows-that-ended-too-soon">great '90s show that ended far too soon</a> was <em>My So-Called Life</em>, which starred Claire Danes in the Golden Globe-winning main role of struggling teen Angela Chase. One of the few episodes not narrated by Angela is the revered "Life of Brian," which primarily focuses on the personal struggles of her friend, Brian Krakow (Devon Gummersall).</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="2BXRoHThG568Awav2EH8mb" name="xfilescigarette" alt="The Cigarette Smoking Man in “Musings Of A Cigarette Smoking Man” on The X-Files" src="https://cdn.mos.cms.futurecdn.net/2BXRoHThG568Awav2EH8mb.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Fox)</span></figcaption></figure><h2 id="musings-of-a-cigarette-smoking-man-the-x-files">“Musings Of A Cigarette Smoking Man” - The X Files</h2><p>The first episode of <em>The X Files</em> in which David Duchovny's Fox Mulder does not appear at all and Dana Scully (Gillian Anderson) is only seen briefly in archival footage from the pilot episode is "Musings of a Cigarette Smoking Man." The Season 4 episode sheds light on the past of the mysterious recurring role (William B. Davis), portraying him almost as a Forrest Gump-like figure for historical assassinations, such as JFK.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="bdLuYGpWKTQdg2GF4J67Gm" name="buffyzeppo" alt="Nicholas Brendon as Xander on Buffy the Vampire Slayer" src="https://cdn.mos.cms.futurecdn.net/bdLuYGpWKTQdg2GF4J67Gm.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Twentieth Century Fox)</span></figcaption></figure><h2 id="the-zeppo-buffy-the-vampire-slayer">“The Zeppo” - Buffy The Vampire Slayer</h2><p>In the Season 3 <em>Buffy the Vampire Slayer</em> episode, "The Zeppo," the titular teen warrior (Sarah Michelle Gellar) is faced with a problem that is merely the B-plot. The main storyline focuses on Xander (Nicholas Brendon), who likens himself to Zeppo Marx, feeling like the gang's most expendable member, until he must singlehandedly take on a group of reanimated corpses conspiring to blow up his high school.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="jbb2zeRPGrZAd2PQA6xUCF" name="scrubshisstory" alt="John C. McGinley as Dr. Cox on Scrubs" src="https://cdn.mos.cms.futurecdn.net/jbb2zeRPGrZAd2PQA6xUCF.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="his-story-scrubs">“His Story” - Scrubs</h2><p>There are several episodes of <em>Scrubs</em> that pass narrative duties from J.D. (Zach Braff) onto another character. The first of the bunch was Season 2's "His Story," which follows Dr. Perry Cox (John C. McGinley) as he speaks with his therapist about issues he is experiencing in his personal life.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="EroBaDqrhndeeK6gMpmjBC" name="himym tracy.jpg" alt="Cristin Milioti on How I Met Your Mother" src="https://cdn.mos.cms.futurecdn.net/EroBaDqrhndeeK6gMpmjBC.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBS)</span></figcaption></figure><h2 id="how-your-mother-met-me-how-i-met-your-mother">"How Your Mother Met Me" - How I Met Your Mother</h2><p>After finally meeting Tracy "The Mother" McConnell (Cristin Milioti) in the Season 8 finale, watching her mingle with the rest of the gang, and catching glimpses of her relationship with Ted (Josh Radnor) throughout Season 9, we finally got to know her personally in <em>How I Met Your Mother</em>'s 200th episode. Chronicling the series' entire timeline up to that point all from her perspective (during which she experiences heartbreaking tragedy, tough life decisions, and The Naked Man), "How Your Mother Met Me" is easily considered one of the <a href="https://www.cinemablend.com/television/the-best-how-i-met-your-mother-episodes-ranked">best <em>HIMYM</em> episodes</a>.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="DFpdRohxcZsMAXe683bgfd" name="Din-Djarin-and-the-Darksaber (1).jpg" alt="Mando in The Book of Boba Fett." src="https://cdn.mos.cms.futurecdn.net/DFpdRohxcZsMAXe683bgfd.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Disney+)</span></figcaption></figure><h2 id="chapter-5-return-of-the-mandalorian-the-book-of-boba-fett">"Chapter 5: Return Of The Mandalorian" - The Book Of Boba Fett</h2><p>After Tamuera Morrison took on the iconic role of Boba Fett on <em>The Mandalorian</em> Season 2, he became the star of his own seven-part spin-off, <em>The Book of Boba Fett</em>. However, the fifth chapter sees the limited series <a href="https://www.cinemablend.com/star-wars/how-the-book-of-boba-boba-fett-just-set-up-big-things-for-the-mandalorian-season-3">essentially become <em>The Mandalorian</em> Season 2.5</a> as it focuses entirely on Pedro Pascal's Din Djarin, who ends up becoming the star of the show from that point on.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="8h5y37oTkdbjkcNdo8yzqk" name="last of us bill and frank.jpg" alt="Bill and Frank at piano in The Last of Us" src="https://cdn.mos.cms.futurecdn.net/8h5y37oTkdbjkcNdo8yzqk.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: HBO)</span></figcaption></figure><h2 id="long-long-time-the-last-of-us">"Long, Long Time" - The Last Of Us</h2><p>The most widely celebrated episode of HBO's series adaptation of the popular video game series, <em>The Last of Us</em>, spends the least amount of time with our central protagonists, Joel (Pedro Pascal) and Ellie (Bella Ramsey). The Emmy-winning "Long, Long Time" is also the first and last episode to feature the characters of Bill (Nick Offerman) and Frank (Murray Bartlett), tracing their loving relationship over several years after the cordyceps outbreak.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="7V9YCvwww775oNvyF7udpM" name="ATL_206_0430r.jpg" alt="Donald Glover on Atlanta" src="https://cdn.mos.cms.futurecdn.net/7V9YCvwww775oNvyF7udpM.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: FX)</span></figcaption></figure><h2 id="teddy-perkins-atlanta">"Teddy Perkins" - Atlanta</h2><p>Arguably, the <a href="https://www.cinemablend.com/television/2547564/the-best-atlanta-episodes-ranked">best episode of <em>Atlanta</em></a> has very little to do with creator Donald Glover's Earn or Alfred (Brian Tyree Henry) but does heavily feature Glover in a whole different kind of role. The main focus of Season 2's "Teddy Perkins" is Lakeith Stanfield's Darius, who is seeking to buy a piano from the episode's reclusive, eccentric title character (played by a nearly unrecognizable Glover under heavy makeup, who is discovered to be hiding a disturbing secret.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="Axws2ypevCZWrYCWa2hod6" name="batmanalmost" alt="Poison Ivy, Penguin, Joker, Two-Face playing Poker on Batman: The Animated Series" src="https://cdn.mos.cms.futurecdn.net/Axws2ypevCZWrYCWa2hod6.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Warner Bros. / DC)</span></figcaption></figure><h2 id="almost-got-im-batman-the-animated-series">"Almost Got 'Im" - Batman: The Animated Series</h2><p>Many DC fans agree that the <a href="https://www.cinemablend.com/television/2571934/the-best-batman-the-animated-series-episodes-ranked">best episode of <em>Batman: The Animated Series</em></a> is one that shifts the perspective from Kevin Conroy's Dark Knight to the five most notorious members of his rogues gallery. In "Almost Got 'Im," Poison Ivy, The Penguin, The Joker, Two-Face, and Killer Croc gather for a Poker game, during which they trade stories about the times they came closest to defeating the Caped Crusader.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="iaDGw7Gjrkhv4LVD62UjUK" name="housewilson" alt="Robert Sean Leonard looking concerned as Wilson on House" src="https://cdn.mos.cms.futurecdn.net/iaDGw7Gjrkhv4LVD62UjUK.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Fox)</span></figcaption></figure><h2 id="wilson-house">"Wilson" - House</h2><p>Considering how the titular diagnostician from <em>House</em> (played by Hugh Laurie) is inspired by Sherlock Holmes (whose stories are narrated by John Watson), it is funny that the medical drama is not told from the perspective of the "Watson" in his life. That would change in Season 6 with the airing of "Wilson," which follows Robert Sean Leonard's Dr. James Wilson racing to save the life of his friend, Tucker (Joshua Malina).</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="iYEXdH3RgJEpbLKWf5ybBd" name="rickandmortyricklantis.jpg" alt="Rick and Morty, "The Ricklantis Mixup"" src="https://cdn.mos.cms.futurecdn.net/iYEXdH3RgJEpbLKWf5ybBd.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Adult Swim)</span></figcaption></figure><h2 id="the-ricklantis-mixup-rick-and-morty">"The Ricklantis Mixup" - Rick And Morty</h2><p>Technically, this <a href="https://www.cinemablend.com/television/2486482/10-best-rick-and-morty-episodes-ranked">classic <em>Rick and Morty</em> episode</a> shows <em>more</em> of the titular duo than any other but because it is really told from the point of view of their many alternate selves, it deserves a spot. The misleadingly titled "The Ricklantis Mixup" is essentially a mini-anthology movie that takes place during a day at the Citadel of Ricks from various perspectives.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="phnULcpvUC2bW4XH5DisDB" name="lostexpose" alt="Nikki and Paulo looking up at a tree on Lost" src="https://cdn.mos.cms.futurecdn.net/phnULcpvUC2bW4XH5DisDB.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><h2 id="expose-lost">"Exposé" - Lost</h2><p>Out of the many survivors of the plane crash, only a chosen few were recognized as main members of the <a href="https://www.cinemablend.com/television/Lost-Cast-Then-Now-116017.html"><em>Lost</em> cast</a> but one episode revealed the backstories of two lesser-seen survivors. "Exposé" begins with Nikki (Kiele Sanchez) and Paulo (Rodrigo Santoro) found dead before flashing back to the couple's lives before the island and their experiences on it.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="Ja2zfSqkHjt5MhyJgybgLj" name="ojjury" alt="The jury from American Crime Story: The People v. O.J. Simpson" src="https://cdn.mos.cms.futurecdn.net/Ja2zfSqkHjt5MhyJgybgLj.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: FX)</span></figcaption></figure><h2 id="a-jury-in-jail-american-crime-story-the-people-v-o-j-simpson">"A Jury In Jail" - American Crime Story: The People v. O.J. Simpson</h2><p>The eighth episode of <em>American Crime Story: The People v. O.J. Simpson</em> still depicts a great deal of the legendary trial from the perspective of the accused former athlete (played by Cuba Gooding Jr.) and the opposing legal teams. However, the focus does shift more heavily to the jury and their alternates as sequestration begins to have a challenging effect on them.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="hwA5k8cvKX49YpJ3BuWPXG" name="tedlassobeard" alt="Brendan Hunt as Coach Beard on Ted Lasso" src="https://cdn.mos.cms.futurecdn.net/hwA5k8cvKX49YpJ3BuWPXG.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Apple Studios)</span></figcaption></figure><h2 id="beard-after-hours-ted-lasso">"Beard After Hours" - Ted Lasso</h2><p>In Season 2 of one of the <a href="https://www.cinemablend.com/television/2566890/the-best-apple-tv-shows-to-watch-including-ted-lasso">best Apple TV+ original TV shows</a>, <em>Ted Lasso</em>, "Man City" sees Coach Beard (Brendan Hunt) go off on his own after AFC Richmond suffers a tough loss. The following episode, "Beard After Hours," sees what the character went through after he walked away, which involves an epic, night-long journey of debauchery, self-discovery, and near-death experiences.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="cstTofXLpgCuQU4oQeJ8B7" name="sopranospine" alt="Christopher and Paulie in the woods in The Sopranos" src="https://cdn.mos.cms.futurecdn.net/cstTofXLpgCuQU4oQeJ8B7.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: HBO)</span></figcaption></figure><h2 id="pine-barrens-the-sopranos">"Pine Barrens" - The Sopranos</h2><p>Tony (James Gandolfini) and his souring affair with Gloria is the B-plot of the Season 3 <em>Sopranos</em> episode, "Pine Barrens." The central focus is Christopher (Michael Imperioli) and Paulie (Tony Sirico), who come close to freezing to death after getting lost in the woods after being tasked with running collections for the flu-ridden Silvio.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="8FVjxG8ir3tAxGuySYrmTb" name="carey mulligan doctor who.jpg" alt="Carey Mulligan in Doctor Who." src="https://cdn.mos.cms.futurecdn.net/8FVjxG8ir3tAxGuySYrmTb.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: BBC)</span></figcaption></figure><h2 id="blink-doctor-who">"Blink" - Doctor Who</h2><p>One of the most acclaimed (and frightening) modern episodes of <em>Doctor Who</em>, "Blink," barely features David Tennant's eponymous time lord or his companion, Martha Jones (Freema Agyeman), due to them becoming stuck in the year 1969. Thus, it is up to a woman from the present day named Sally Sparrow (Academy Award nominee Carey Mulligan) to prevent statue-esque creatures called Weeping Angels from taking control of the TARDIS.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="MWBzVYNSgmM74mVqzQ5zA6" name="davetaco" alt="Travis Bennett as Elz in a recording studio on Dave" src="https://cdn.mos.cms.futurecdn.net/MWBzVYNSgmM74mVqzQ5zA6.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: FX)</span></figcaption></figure><h2 id="what-wood-you-wear-dave">"What Wood You Wear?" - Dave</h2><p>While FX's <em>Dave</em> is a fictionalized look at the rise of Dave "'Lil Dicky" Burd (who also co-creates and stars as himself), the humorous hip-hop artist was sure not to hog the spotlight for the first season's entirety. In the seventh episode, "What Wood You Wear?," Dave's buddy Elz (Travis "Taco" Bennett) takes center stage as it follows him DJing at a silent disco and sparking a romantic connection with Emma (Christine Ko).</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="xNJXSqrx6bgGwkZBdz267Y" name="the governor the walking dead.png" alt="David Morrissey in The Walking Dead." src="https://cdn.mos.cms.futurecdn.net/xNJXSqrx6bgGwkZBdz267Y.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: AMC)</span></figcaption></figure><h2 id="live-bait-the-walking-dead">"Live Bait" - The Walking Dead</h2><p>Season 3 of <em>The Walking Dead</em> ended with The Governor (David Morrissey) wiping out most of his crew and taking off with the last of his loyal henchpeople. The sixth episode of the fourth season, "Live Bait," fills us in on what he had been up to since then, showing evidence of redemption since Woodbury's destruction as he bonds with a small family but also evidence of a further descent into madness, which leads to his attack on the prison.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="9H7X46rqEschvG7DNKcutW" name="bojackhollyhock" alt="Hollyhock sitting on a fire escape on BoJack Horseman" src="https://cdn.mos.cms.futurecdn.net/9H7X46rqEschvG7DNKcutW.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="a-quick-one-while-he-s-away-bojack-horseman">"A Quick One, While He's Away" - BoJack Horseman</h2><p>In addition to any of the main characters from Netflix's animated <a href="https://www.cinemablend.com/television/100-best-tv-sitcoms-of-all-time-ranked">acclaimed TV sitcom</a>, <em>BoJack Horseman</em>, Will Arnett's eponymous washed-up celebrity does not show up, nor is he mentioned by name in Season 6's "A Quick One, While He's Away." However, the episode does focus on characters who have been heavily, and mostly negatively, affected by his actions, based on their implied references to him.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="bxSNFXjAygR6YFmgwntpeA" name="manseekingwomenteacup" alt="Britt Lower looking uncomfortably surprised on Man Seeking Woman" src="https://cdn.mos.cms.futurecdn.net/bxSNFXjAygR6YFmgwntpeA.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: FX)</span></figcaption></figure><h2 id="teacup-man-seeking-woman">"Teacup" - Man Seeking Woman</h2><p>Creator Simon Rich's absurd romantic fantasy satire, <em>Man Seeking Woman,</em> is told largely from a male perspective (specifically that of Jay Baruchel's Josh Greenberg) but flips the script with Season 1's "Teacup," which makes Josh's sister, Liz (future <a href="https://www.cinemablend.com/streaming-news/severance-cast-where-youve-seen-the-actors-from-ben-stillers-apple-tv-drama-series"><em>Severance</em> cast</a> member, Britt Lower), the star. Liz experiences common pains of modern dating in a ridiculously exaggerated manner, from becoming jealous of a group of married girls who are much younger (elementary school age, to be exact) to literally Frankensteining the perfect man for her, only to learn he is gay.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="uQhtHs5mCbDqbnjr9J3QyP" name="avatarzuko" alt="Zuko in a hat on Avatar: The Last Airbender" src="https://cdn.mos.cms.futurecdn.net/uQhtHs5mCbDqbnjr9J3QyP.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Nickelodeon)</span></figcaption></figure><h2 id="zuko-alone-avatar-the-last-airbender">"Zuko Alone" - Avatar: The Last Airbender</h2><p>One of the most interesting ways that a TV show can shake things up is by making its main antagonist the star of an episode, such as "Zuko Alone" from Nickelodeon's original <em>Avatar: The Last Airbender</em> series. The seventh chapter of "Book Two: Earth" sees the Firebender (voiced by Dante Basco) reminiscing about his childhood after he is exiled from his village.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="29BNg9dxkxQasS5C24A5bW" name="masterofnonenewyork" alt="Eddie from "New York, I Love You" on Master of None" src="https://cdn.mos.cms.futurecdn.net/29BNg9dxkxQasS5C24A5bW.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="new-york-i-love-you-master-of-none">"New York, I Love You" - Master Of None</h2><p>In a Season 2 episode of Netflix's <em>Master of None</em> called "New York, I Love You," Dev (co-creator Aziz Ansari) and his friends only appear in the bookend scenes. Instead, the focus shifts primarily toward the intersecting lives of a group of never-before-seen working-class New Yorkers, including a doorman, a deaf cashier, and a taxi driver.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="4axGjgbEDDMuXusUgacixS" name="highfidelitysimon" alt="David H. Holmes as Simon breaking the fourth wall on High Fidelity" src="https://cdn.mos.cms.futurecdn.net/4axGjgbEDDMuXusUgacixS.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Hulu)</span></figcaption></figure><h2 id="ballad-of-the-lonesome-loser-high-fidelity">“Ballad Of The Lonesome Loser" - High Fidelity</h2><p>Much like the <a href="https://www.cinemablend.com/movies/best-music-movies-of-all-time-ranked">classic music movie</a> Nick Hornby's novel inspired in 2000, Hulu's series adaptation of <em>High Fidelity</em> follows the romantic challenges of record store owner Rob Gordon (Zoë Kravitz)... except for Episode 8. In "Ballad of the Lonesome Loser," Rob's gay friend and coworker Simon (David H. Holmes) gets the chance to break the fourth wall and discuss his romantic struggles.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="7nucbwvxjXGS9tRPXE3Cog" name="spongebobplanktonalgae" alt="Plankton wearing Mr. Krabs clothes on SpongeBob Squarepants" src="https://cdn.mos.cms.futurecdn.net/7nucbwvxjXGS9tRPXE3Cog.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Nickelodeon)</span></figcaption></figure><h2 id="the-algae-s-always-greener-spongebob-squarepants">“The Algae's Always Greener" - SpongeBob Squarepants</h2><p>Plankton (voiced by Mr. Lawrence) has been the primary focus in a few episodes of <em>SpongeBob Squarepants</em>, the funniest and most amusing of which would have to be "The Algae's Always Greener." Fed up with always failing in his attempts to steal the Krabby Patty Secret Formula, the pint-sized Chum Bucket owner uses a special device that allows him to experience life from the perspective of his longtime rival, Mr. Krabs (Clancy Brown).</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="MY7wvLYaDT2bs5vDuN4967" name="babylon5lowerdeck" alt="Custodial staff from Babylon 5" src="https://cdn.mos.cms.futurecdn.net/MY7wvLYaDT2bs5vDuN4967.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Warner Bros. Television)</span></figcaption></figure><h2 id="a-view-from-the-gallery-babylon-5">"A View From The Gallery" - Babylon 5</h2><p>Years after <em>Star Trek: The Next Generation</em> helped coin the "lower decks episode" term, <em>Babylon 5</em> – a sci-fi series that earns many comparisons to the <em>Star Trek</em> franchise – released its own. "A View from the Gallery" is told largely from the perspective of the eponymous space station's custodial crew.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="Nh7ARoT45BGBAg9Gpiu35a" name="atl 3 cover.jpg" alt="Zazie Beetz on Atlanta" src="https://cdn.mos.cms.futurecdn.net/Nh7ARoT45BGBAg9Gpiu35a.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: FX)</span></figcaption></figure><h2 id="tarrare-atlanta">"Tarrare" - Atlanta</h2><p>The <a href="https://www.cinemablend.com/television/atlanta-season-3-ending-explained">Season 3 finale of <em>Atlanta</em></a>, "Tarrare," provided an eye-opening explanation for Vanessa's (Zazie Beetz) unusual behavior, showing that she has adopted a bizarre alternate personality, and a French accent while living in Paris. Donald Glover's Earn is the only other main character to appear in the episode but does not show up until the even weirder post-credit sequence.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="yjcU9oafNKsSzrLvwzoX7S" name="housecuddy" alt="Lisa Edelstein as Cuddy smiling on House" src="https://cdn.mos.cms.futurecdn.net/yjcU9oafNKsSzrLvwzoX7S.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Fox)</span></figcaption></figure><h2 id="5-to-9-house">"5 To 9" - House</h2><p>After dedicating an entire episode to Robert Sean Leonard's Wilson, <em>House</em> gave Lisa Edelstein's Dr. Lisa Cuddy the same treatment. Season 6's "5 to 9" follows a day in the life of Princeton-Plainsboro Teaching Hospital's Dean of Medicine and Chief Hospital Administrator.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="nWRgmHzoNsysmVa9mBhUFb" name="himymillumination" alt="Cobie Smulders as Robin sitting on a bench in the snow drinking egg nog on How I Met Your Mother" src="https://cdn.mos.cms.futurecdn.net/nWRgmHzoNsysmVa9mBhUFb.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBS)</span></figcaption></figure><h2 id="symphony-of-illumination-how-i-met-your-mother">"Symphony Of Illumination" - How I Met Your Mother</h2><p>In the Season 7 episode, "Symphony of Illumination," <a href="https://www.cinemablend.com/television/2474932/how-i-met-your-mother-whats-the-cast-up-to-now"><em>How I Met Your Mother</em> cast</a> member Cobie Smulders' Robin Scherbatsky takes over as the narrator to tell her future son and daughter about her and Barney's (Neil Patrick Harris) pregnancy scare. However, she later discovers that she is actually unable to have children and the kids she was talking to only existed in her imagination.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="GsbdF4mrEuWryrGALPj6c" name="personofinterestrelevance" alt="Sameen Shaw (Sarah Shahi) walking through Berlin on Person of Interest" src="https://cdn.mos.cms.futurecdn.net/GsbdF4mrEuWryrGALPj6c.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBS)</span></figcaption></figure><h2 id="relevance-person-of-interest">“Relevance” - Person Of Interest</h2><p>Season 2 of CBS' <em>Person of Interest</em> introduced a new character named Sameen Shaw (Sarah Shahi) in an episode that made her the star of most of the action.</p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ BoJack Horseman Creator Has A New Netflix Show Coming, And It Sounds Like It'll Be Just As Comedically Traumatic ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/streaming-news/bojack-horseman-creator-new-netflix-show-comedically-traumatic</link>
                                                                            <description>
                            <![CDATA[ BoJack Horseman remains a Netflix classic, and its creator now has a new show in the works on the streaming giant. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">P3MkiDBjGMScBMwW7LUXo4</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/9EGiRTEfRCSVaAndXifGu6-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Thu, 22 Aug 2024 19:32:00 +0000</pubDate>                                                                                                                                                                                                                                <category><![CDATA[Streaming News]]></category>
                                                                                                                    <dc:creator><![CDATA[ Nick Venable ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/TzeQjfZT5cKqHRsEqudtqT.png ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Nick Venable is an Assistant Managing Editor, and the TV Editor. His humble origin story with CinemaBlend began all the way back in the pre-streaming era, circa 2009, as a freelancing DVD reviewer and TV recapper. After rising up through the ranks covering Movies, Nick leapfrogged over to the small screen to cover more and more television news and interviews, eventually taking over the section for the current era. Born in Louisiana and currently living in Texas — Who Dat Nation over America’s Team all day, all night — Nick spent several years in the hospitality industry, and also worked as a 911 operator. And if you ever happened to hear his music or read his comics/short stories, you have his sympathy. His love for his wife and daughters is almost equaled by his love of gasp-for-breath laughter and gasp-for-breath horror. A lifetime spent in the vicinity of a television screen led to his current dream job, as well as his knowledge of too many TV themes and ad jingles.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What He&#039;s Into&lt;/strong&gt;: Nick is one of those people who won’t necessarily insert a Monty Python reference into every conversation, but is still mentally equipped to do so. Beyond such appreciation for surreal UK comedy, Nick also indulges in as much horror splendor as possible, from Stephen King novels to James Tynion IV comics to Freddy Krueger one-liners to all things Mike Flanagan. Throw in a dash of NFL, some 311 and Weird Al, fried crawfish poboys, bourbon, ‘90s-era pro wrestling, crossword puzzles and mystery-driven video games, and baby, you got a stew going. (Nick will insert an Arrested Development reference into every conversation, if possible.)&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What He&#039;s Excited About&lt;/strong&gt;: Anything Jeff Lemire, Tom King and W. Maxwell Prince think of, ever. More of Kelly Reilly’s deliriously fierce performances on Yellowstone. HBO’s The Last of Us. Clone High’s return. Colin Farrell’s Penguin being in every movie/TV show/breakfast cereal.&lt;/p&gt; ]]></dc:description>
                                                                                                                                <cf:isSponsored>false</cf:isSponsored>
                <cf:hasAffiliateLinks>false</cf:hasAffiliateLinks>
                <cf:isPaid>false</cf:isPaid>
                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/9EGiRTEfRCSVaAndXifGu6-1280-80.jpg">
                                                            <media:credit><![CDATA[netflix]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[Close-up of BoJack &#039;s worried face as he scratches his head talking to Todd on the beach in BoJack Horseman Season 6]]></media:description>                                                            <media:text><![CDATA[Close-up of BoJack &#039;s worried face as he scratches his head talking to Todd on the beach in BoJack Horseman Season 6]]></media:text>
                                <media:title type="plain"><![CDATA[Close-up of BoJack &#039;s worried face as he scratches his head talking to Todd on the beach in BoJack Horseman Season 6]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/9EGiRTEfRCSVaAndXifGu6-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>The annals of anthropomorphic TV horses with emotionally crippling personal histories aren’t the most plentiful, and are pretty much limited to <em>BoJack Horseman</em> Seasons 1-6. And that’s fine, because those six seasons comprise one of the <a href="https://www.cinemablend.com/television/100-best-tv-sitcoms-of-all-time-ranked"><u>best TV comedies of all time</u></a>, and it remains a bummer that a new season isn’t hitting <a href="https://www.cinemablend.com/streaming-news/2024-netflix-movie-and-tv-show-release-dates"><u>Netflix’s upcoming TV and movie lineup</u></a>. But huzzah, creator Raphael Bob-Waksberg will be horsin’ around at the streaming giant once more for a new adult animated series.</p><p>Perhaps it should surprise no one who watched all six seasons of <em>BoJack Horseman</em>’s psychological trials and tribulations that Bob-Waksberg’s new project sounds like it could tread similarly hilarious-yet-troubling waters. Here’s how Netflix first described the exciting new project <a href="https://x.com/netflix/status/1826674346963992754"><u>on X</u></a>: </p><div><blockquote><p>BoJack Horseman man Raphael Bob-Waksberg has a new adult animated comedy series coming to Netflix with original artwork from Lisa Hanawalt.</p></blockquote></div><p>That doesn’t sound so bad, right? “Adult animated comedy series” could mean anything, right? Hit the tape! (Or just keep reading for the rest of the description.)</p><div><blockquote><p>Long Story Short is about a family, over time. It's about the shared history, the inside jokes, the old wounds. If you’ve ever had a mother, father, sibling, partner, or child, this is the show for you and by the way would it kill you to call them?</p></blockquote></div><p>You can’t fool me, Raphael Bob-Waksberg! “Family, over time” is precisely the factor that gave the Will Arnett-voiced horse his heftiest emotional baggage. (<a href="https://www.cinemablend.com/television/2457791/bojack-horsemans-best-season-5-episode-is-another-format-breaking-masterpiece"><u>Season 5’s “Free Churro” remains a heartbreaker</u></a> and then some.) And the ideas of a shared history, of inside jokes, and of old wounds? That’s BoJack’s relationship with Sarah Lynn to a T, and could be applied to others.</p><p>And then if we’re talking about partners and children, that could get into a whole other mess of spoiler-filled sob-talk. So let me take a moment to celebrate that the <em>BoJack</em> and <em>Undone</em> creator will once again be working with award-winning illustrator and animator Lisa Hanawalt on the new show. </p><p>She not only provided her talents as a designer for <em>BoJack</em>, but she also created the two-season comedy <em>Tuca & Bertie</em>, which <a href="https://www.cinemablend.com/television/2546807/cancelled-netflix-favorite-is-getting-resurrected-on-cable-channel"><u>Adult Swim picked up after Netflix canceled it</u></a>. It’s good to see that both creators are on good terms with the streaming service, as Bob-Waksberg shared <a href="https://www.cinemablend.com/television/2483868/bojack-horsemans-creator-thinks-its-a-shame-that-netflix-changed-its-cancellation-policy"><u>his disappointment in Netflix’s cancellation policy</u></a> at the time when they pulled the plug. (In hindsight, <em>BoJack</em> lasted way longer than current streaming shows.)</p><div  class="fancy-box"><div class="fancy_box-title"></div><div class="fancy_box_body"><figure class="van-image-figure "  ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="zSP5mJH57quAXDWZoXQnXo" name="2024BestStreaming_HEADER_master.png" caption="" alt="Eleven from Stranger Things on Netflix, Shogun from Hulu, Game of Thrones" src="https://cdn.mos.cms.futurecdn.net/zSP5mJH57quAXDWZoXQnXo.png" mos="" link="" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pinterest-pin-exclude"></p></div></div><figcaption itemprop="caption description" class=""><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix, Max, Hulu)</span></figcaption></figure><p class="fancy-box__body-text"><a data-analytics-id="inline-link" href="https://www.cinemablend.com/streaming-news/best-streaming-services-subscribe"><strong>The Best Streaming Services To Subscribe To In 2024, According To CinemaBlend</strong></a></p></div></div><p>Sure, the word combinations above could all be perfectly innocuous without the intention to imply that this new show <em>Long Story Short</em> will darken anyone’s souls. But let’s not forget that <em>BoJack Horseman</em> started out as a far less intense exploration of addiction, genetic trauma, and other metaphorical skeletons in the closet. And then when we least expected it, probably as Princess Carolyn was bopping some yarn about, the show sunk its claws in for reals. </p><p>As much as I wish <em>Long Story Short</em> will be available to stream as part of the <a href="https://www.cinemablend.com/television/2024-tv-show-premiere-dates-schedule"><u>upcoming TV schedule</u></a>, animated shows tend to take a while before making their debuts. Here’s hoping this announcement is happening in the middle of the creative process, instead of right at the start.</p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ 32 Cartoons That "Weird Al" Has Appeared In ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/cartoons-that-weird-al-has-appeared-in</link>
                                                                            <description>
                            <![CDATA[ You know his voice in his iconic song parodies, but do you recognize "Weird Al" Yankovic's voice from his many animated movie and TV show roles? ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">btmNMgarVfPvpLgxLXxvNU</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/thZphVqibYdqPWNJMrBJfP-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Mon, 12 Aug 2024 16:30:11 +0000</pubDate>                                                                                                                                                                                                                                <category><![CDATA[Television]]></category>
                                                                                                                    <dc:creator><![CDATA[ Jason Wiese ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/ZWUcQovBZAtQqcvqB5DKQm.png ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Jason Wiese writes feature stories for CinemaBlend. His occupation results from years dreaming of a filmmaking career, settling on a &quot;professional film fan&quot; career, studying journalism at Lindenwood University in St. Charles, MO (where he served as Culture Editor for its student-run print and online publications), and a brief stint of reviewing movies for fun. He would later continue that side-hustle of film criticism on TikTok (@wiesewisdom), where he posts videos on a semi-weekly basis.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;Jason has been writing since he was able to pick up a washable marker, with which he wrote his debut illustrated children&#039;s story, later transitioning to a short-lived comic book series and (very) amateur filmmaking before finally settling on pursuing a career in writing about movies in lieu of making them. Look for his name in almost any article about Batman.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What He&#039;s Into&lt;/strong&gt;: Readers may notice a recurring theme of horror and superhero-related content (especially in regards to Batman) in much of Jason&#039;s work, but his favorite film of all time is more in line with traditional action/adventure stories: &lt;em&gt;Raiders of the Lost Ark&lt;/em&gt;. His favorite TV series is the gritty, grounded crime thriller &lt;em&gt;Breaking Bad&lt;/em&gt; and if you catching him reading anything, it is probably a comic book (and, more often than not, one featuring Batman). More important to him than entertainment, however, are his wife and two dogs.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What He&#039;s Excited About Right Now&lt;/strong&gt;: Jason typically tries to keep his excitement and expectations for any upcoming movies as low as possible, but he is certainly looking forward to the second halves of &lt;em&gt;Spider-Man: Across the Spider-Verse &lt;/em&gt;(&lt;em&gt;Beyond the Spider-Verse&lt;/em&gt;) and &lt;em&gt;Mission: Impossible - Dead Reckoning&lt;/em&gt;, as well as Tim Burton&#039;s long, LONG-awaited follow-up to a very film in his household, &lt;em&gt;Beetlejuice&lt;/em&gt;. However, even more than any of those sequels, he is especially looking forward to returning to Matt Reeves&#039; vision of Gotham City in the upcoming follow-up to &lt;em&gt;The Batman&lt;/em&gt;.&lt;/p&gt; ]]></dc:description>
                                                                                                                                <cf:isSponsored>false</cf:isSponsored>
                <cf:hasAffiliateLinks>false</cf:hasAffiliateLinks>
                <cf:isPaid>false</cf:isPaid>
                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/thZphVqibYdqPWNJMrBJfP-1280-80.jpg">
                                                            <media:credit><![CDATA[Fox]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[Weird Al Yankovic on The Simpsons]]></media:description>                                                            <media:text><![CDATA[Weird Al Yankovic on The Simpsons]]></media:text>
                                <media:title type="plain"><![CDATA[Weird Al Yankovic on The Simpsons]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/thZphVqibYdqPWNJMrBJfP-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>While he is best known as the maestro of some of the funniest musical parodies of all time, there are also many <a href="https://www.cinemablend.com/movies/great-weird-al-yankovic-appearances-in-movies-and-tv-shows">great "Weird Al" Yankovic appearances in movies and TV shows</a> that any fan of the artist should know about. In fact, a great deal of them happen to be in animated features and series. Take a look back on some of the many notable times "Weird Al" lent his voice to a fun cartoon role.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="SdJ33kt2YiN7sqMVEKYu78" name="weirdalamericandad.jpg" alt="Weird Al scene from American Dad" src="https://cdn.mos.cms.futurecdn.net/SdJ33kt2YiN7sqMVEKYu78.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Fox)</span></figcaption></figure><h2 id="american-dad-2005-present">American Dad (2005-Present)</h2><p>While "Weird Al" never actually appears in a role on <em>American Dad</em>, he does perform a song written exclusively for a Season 15 episode of co-creator Seth McFarlane&apos;s political comedy. When Stan (McFarlane) and a rabbit costume-clad Roger (also McFarlane) plan to sabotage a farm, they come up with an idea for a parody of the Beastie Boys&apos; "Sabotage" called "Rabbitage." While the artist himself formally rejects the request for the song, they discover he wrote and recorded it himself anyway.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="7k6vgPovjJ5iHRgyqfPNUA" name="weird al bojack.jpg" alt="Will Arnett and Weird Al Yankovic on BoJack Horseman" src="https://cdn.mos.cms.futurecdn.net/7k6vgPovjJ5iHRgyqfPNUA.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="bojack-horseman-2014-2020-2">Bojack Horseman (2014-2020)</h2><p>One of the most famous examples of "Weird Al" voicing an original animated character is Captain Peanutbutter, the brother of Paul F. Thompkins’ Mr. Peanutbutter, on one of the <a href="https://www.cinemablend.com/television/the-75-best-animated-TV-shows-of-all-time">all-time best-animated TV shows</a>, Netflix’s <em>BoJack Horseman</em>. He was asked to play the recurring character by executive producer and series regular Aaron Paul who had previously portrayed the musician in a fake trailer for his biopic that would later be made into his "real" biopic.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="JTNuKkw9VfHTgmXSi4vZtB" name="weirdaljohnnybravo2.jpg" alt=""Weird Al" on Johnny Bravo" src="https://cdn.mos.cms.futurecdn.net/JTNuKkw9VfHTgmXSi4vZtB.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Cartoon Network)</span></figcaption></figure><h2 id="johnny-bravo-1997-2004">Johnny Bravo (1997-2004)</h2><p>"Weird Al&apos;s" appearance on Cartoon Network&apos;s <em>Johnny Bravo</em> was not at all what you would expect, but that is essentially what makes it so perfect. He teams up with none other than comedy legend Don Knotts and a superhero named Blue Falcon to host a <em>Queer Eye</em>-esque TV show called <em>Cartoon Makeover</em>, and their latest client is the titular, bumbling "mimbo" (voiced by Jeff Bennett).</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="NeFTVpYuCaExgeRjjPHDEN" name="weirdalscoobydoo.jpg" alt=""Weird Al" on Scooby-Doo And Guess Who?" src="https://cdn.mos.cms.futurecdn.net/NeFTVpYuCaExgeRjjPHDEN.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Warner Bros.)</span></figcaption></figure><h2 id="scooby-doo-and-guess-who-2019-2021">Scooby-Doo And Guess Who? (2019-2021)</h2><p><a href="https://www.cinemablend.com/television/2476163/from-john-cena-to-steve-urkel-the-weirdest-scooby-doo-crossovers">Mystery Inc. has crossed paths</a> with multiple celebrities on <em>Scooby-Doo & Guess Who?</em>, including "Weird Al." In the 2019 episode, "Attack of the Weird Al-osaurus," he meets Scooby and the gang when they come to investigate rumors that a dinosaur is terrorizing his camp for teaching children the accordion.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="aPAi3WM9pqVicfy67xzPZK" name="weirdalmilo.jpg" alt=""Weird Al" on Milo Murphy's Law" src="https://cdn.mos.cms.futurecdn.net/aPAi3WM9pqVicfy67xzPZK.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Disney)</span></figcaption></figure><h2 id="milo-murphy-apos-s-law-2016-2019">Milo Murphy&apos;s Law (2016-2019)</h2><p>One of "Weird Al&apos;s" most underrated animated characters is not a cameo or guest appearance, nor even a recurring stint, but a starring role as the lead in a series. For 40 episodes, Yankovic voiced the clumsy titular teen of the Disney XD original series, <em>Milo Murphy&apos;s Law</em>, from <em>Phineas and Ferb</em> creators Jeff "Swampy" Marsh and Dan Povenmire.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="SsFLUo8AyN4vE2tmLgWcYQ" name="weird al darkseid.jpg" alt="Weird Al Yankovic as Darkseid on Teen Titans Go!" src="https://cdn.mos.cms.futurecdn.net/SsFLUo8AyN4vE2tmLgWcYQ.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Warner Bros.)</span></figcaption></figure><h2 id="teen-titans-go-2013-present">Teen Titans GO! (2013-Present)</h2><p>Yankovic would go wildly against type to play one of the most notorious villains in DC Comics history, Darkseid, for four episodes of <em>Teen Titans Go!</em> In one of those episodes, Cyborg (Phil LaMarr) actually points out how the tyrannical New God sounds strangely like the musical comedian and even sets off an epic standoff when he quips that Darkseid could not be as evil as someone who makes "songwriters look like fools."</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="AhG6EEDLwbgc3aQENRdHcV" name="weirdalrobotchicken2.jpg" alt="Weird Al Yankovic on Robot Chicken" src="https://cdn.mos.cms.futurecdn.net/AhG6EEDLwbgc3aQENRdHcV.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Adult Swim)</span></figcaption></figure><h2 id="robot-chicken-2001-2022">Robot Chicken (2001-2022)</h2><p>"Weird Al" has shown up on Adult Swim&apos;s Emmy-winning stop-motion satire, <em>Robot Chicken</em>, a few different times. One sketch actually served as the official music video from his 2006 song, "Weasel Stomping Day," and a later appearance saw him take the place of the Doof Warrior in a send-up of the 2015 <a href="https://www.cinemablend.com/news/2565790/the-best-action-movies-and-how-to-watch-them">action movie favorite</a>, <em>Mad Max: Fury Road</em>.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="yCU6C7h2W2zUaeuxFis8C8" name="weirdalvoltron.jpg" alt="Weird Al Yankovic on Voltron: Legendary Defender" src="https://cdn.mos.cms.futurecdn.net/yCU6C7h2W2zUaeuxFis8C8.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: DreamWorks / Netflix)</span></figcaption></figure><h2 id="voltron-legendary-defender-2016-2018">Voltron: Legendary Defender (2016-2018)</h2><p>"Weird Al" is part of the <em>Voltron</em> universe, having lent his voice to Netflix and DreamWorks&apos; reboot, <em>Voltron: Legendary Defender</em>. In a Season 2 episode called, "The Depths," he voices an alien named Blumfump, who hides his face behind a jellyfish he wears as a mask and enlists the help of Lance (Jeremy Shada) to stop a brainwashing plot on his planet.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="P8GVQdZAmjtYsT5G9c47x5" name="weirdaladventuretime.jpg" alt="Weird Al Yankovic on Adventure Time" src="https://cdn.mos.cms.futurecdn.net/P8GVQdZAmjtYsT5G9c47x5.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Cartoon Network)</span></figcaption></figure><h2 id="adventure-time-2010-2018">Adventure Time (2010-2018)</h2><p>Pendleton Ward enlisted the vocal talents of "Weird Al" for three episodes of his hit fantasy series, <em>Adventure Time</em>, as Banana Man. The mechanically handy recurring character gets his name for his resemblance to the yellow fruit.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="3HkRapptQQn6D4ogYPvKZY" name="weirdalgravityfalls.jpg" alt="Weird Al Yankovic on Gravity Falls" src="https://cdn.mos.cms.futurecdn.net/3HkRapptQQn6D4ogYPvKZY.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Disney)</span></figcaption></figure><h2 id="gravity-falls-2012-2016">Gravity Falls (2012-2016)</h2><p>"Weird Al" has actually played a few interesting animated villains, such as on Disney XD&apos;s cult favorite supernatural adventure comedy, <a href="https://www.cinemablend.com/television/Check-Out-Gravity-Falls-Creator-Touching-Thank-You-Fans-118347.html"><em>Gravity Falls</em>, from creator Alex Hirsch</a>. He voices Probabilitor the Annoying, who is a powerful wizard, but with a crushing weakness of "prime statistical anomalies over 37 but not exceeding 51."</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="eFyQ34f8fgiKwDb77dJj8n" name="weird al simpsons.jpg" alt="Weird Al Yankovic on The Simpsons" src="https://cdn.mos.cms.futurecdn.net/eFyQ34f8fgiKwDb77dJj8n.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Disney)</span></figcaption></figure><h2 id="the-simpsons-1989-present">The Simpsons (1989-Present)</h2><p>One of the few <a href="https://www.cinemablend.com/television/celebrities-who-played-themselves-on-the-simpsons">celebrity guests to voice themselves on <em>The Simpsons</em></a> more than once is “Weird Al” Yankovic — the first being a Season 14 episode in which Marge has Al craft a parody of John Mellencamp’s “Jack & Diane” called “Homer & Marge” to see their marriage. In Season 19, he parodied a song by Homer’s band, Sandgasm (already a parody of Nirvana), and later performed the series&apos; theme song on the accordion for a Season 34 opening couch gag.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="BcCgvTrnCpuz5F8oW6H2Db" name="weirdalbatmanvsrobin.jpg" alt="Weird Al Yankovic on Batman vs. Robin" src="https://cdn.mos.cms.futurecdn.net/BcCgvTrnCpuz5F8oW6H2Db.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Warner Bros. / DC)</span></figcaption></figure><h2 id="batman-vs-robin-2015">Batman Vs. Robin (2015)</h2><p>The main conflict of <em>Batman vs. Robin</em> is between Bruce Wayne (Jason O&apos;Mara) and his son, Damian (Stuart Allen), but one of the first, most exciting, and also unsettling sequences in the 2015 <a href="https://www.cinemablend.com/news/2556429/dc-animated-movie-universe-timeline-explained">DC animated film</a> sees the duo facing off against The Dollmaker. "Weird Al" dons an eerie and unrecognizable voice to portray the villain, who turns kidnapped children into his own army of rabid mutants wearing porcelain faces like masks, just as he does.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="pj27SjNe74LoH9wnXUAc3h" name="weirdalsabrina.jpg" alt="Weird Al Yankovic on Sabrina the Animated Series" src="https://cdn.mos.cms.futurecdn.net/pj27SjNe74LoH9wnXUAc3h.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: DIC)</span></figcaption></figure><h2 id="sabrina-the-animated-series-1999-2000">Sabrina: The Animated Series (1999-2000)</h2><p>"Weird Al" would appear in three episodes of <em>Sabrina: The Animated Series</em>, which saw the famous teenage witch from the Archie Comics return to cartoon form. The artist&apos;s first appearance saw him perform a song called "Electric Shaver."</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="h5fxuBmTCvHF98Cc35uVbb" name="weirdalscottpilgrim.jpg" alt="Characters from Scott Pilgrim Takes Off" src="https://cdn.mos.cms.futurecdn.net/h5fxuBmTCvHF98Cc35uVbb.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="scott-pilgrim-takes-off-2023">Scott Pilgrim Takes Off (2023)</h2><p>"Weird Al" briefly lends his voice alongside the <a href="https://www.cinemablend.com/movies/scott-pilgrim-vs-the-world-cast-what-the-actors-are-doing-now"><em>Scott Pilgrim vs. the World</em> cast</a> to star in Netflix&apos;s anime-style adaptation of Bryan Lee O&apos;Malley&apos;s graphic novel series, <em>Scott Pilgrim Takes Off</em>. The majority of the fifth episode, "Lights. Camera. Sparks?!" is framed as a documentary about the making of a failed movie based on Scott&apos;s life and the opening narration is provided by Al.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="t9xoGpQ85bQLS5C4yKsnXJ" name="weirdalgrim.jpg" alt="Weird Al Yankovic on The Grim Adventures of Billy & Mandy" src="https://cdn.mos.cms.futurecdn.net/t9xoGpQ85bQLS5C4yKsnXJ.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Cartoon Network)</span></figcaption></figure><h2 id="the-grim-adventures-of-billy-amp-mandy-2003-2007">The Grim Adventures Of Billy & Mandy (2003-2007)</h2><p><em>The Grim Adventures Of Billy & Mandy</em> poked fun at Hogwarts&apos; Sorting Hat from the <em>Harry Potter</em> movies by introducing the character, Squidhat. In three episodes, "Weird Al" voices the pink squid who works at Toadblatt&apos;s Summer School of Sorcery assigning students to different houses, but also moonlights as a musician. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="7HzCwBakxoRAfjvUQ5QiH8" name="weirdalliostitch.jpg" alt="Weird Al Yankovic on Lilo & Stitch: The Series" src="https://cdn.mos.cms.futurecdn.net/7HzCwBakxoRAfjvUQ5QiH8.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Disney)</span></figcaption></figure><h2 id="lilo-amp-stitch-the-series-2003-2006">Lilo & Stitch: The Series (2003-2006)</h2><p>In one episode of the series spun-off from the <a href="https://www.cinemablend.com/news/2304282/every-walt-disney-animation-studios-feature-ranked">hit Disney animated movie</a>, <em>Lilo & Stitch</em>, Lilo (Daveigh Chase), Stitch (Chris Sanders), and others go to the Elizabethan Fair, where one of Stitch&apos;s cousins, Tank, happens to be. Throughout the day, a minstrel (voiced by "Weird Al") randomly appears to narrate what takes place in a song, much to the characters&apos; chagrin.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="uTCrYHnXHbiEtAkZeqyfSC" name="weirdaleek.jpg" alt="Weirld Al on Eek! The Cat" src="https://cdn.mos.cms.futurecdn.net/uTCrYHnXHbiEtAkZeqyfSC.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Fox)</span></figcaption></figure><h2 id="eek-the-cat-1992-1997">Eek! The Cat (1992-1997)</h2><p>The Season 5 episode of <em>Eek! The Cat</em> called “The FugEektive” boasts two major cameos, one being <em>America’s Most Wanted</em> host John Walsh, who partners with the titular feline (Bill Kopp) for a crime-chasing program. The second major cameo is “Weird Al,” who appears on John and Eek!’s show with a tip to help their search for Sharky the Shark Dog.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="7aSf6cp4xGZFgKPm2vYMRT" name="weirdalstar.jpg" alt="Weird Al Yankovic on Star vs. the Forces of Evil" src="https://cdn.mos.cms.futurecdn.net/7aSf6cp4xGZFgKPm2vYMRT.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Disney)</span></figcaption></figure><h2 id="star-vs-the-forces-of-evil-2012-2019">Star Vs. The Forces Of Evil (2012-2019)</h2><p>“Weird Al” is the type of person who can make any situation more fun with his presence alone, which is why casting him as the opposite in an episode of <em>Star vs. the Forces of Evil</em> was a stroke of genius. His character, Preston Change-O, is a seemingly average magician who is revealed to have the ability to, literally, suck the fun out of the room, which is the only way he can create any joy for himself.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="NSfdAFKiiccbxFS77MafMB" name="weirdaltransformers.jpg" alt="Weird Al Yankovic on Transformers: Earthspark" src="https://cdn.mos.cms.futurecdn.net/NSfdAFKiiccbxFS77MafMB.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Paramount)</span></figcaption></figure><h2 id="transformers-earthspark-2022-present-xa0">Transformers: Earthspark (2022-Present) </h2><p>"Weird Al" is also a part of the <em>Transformers</em> franchise, having lent his voice to Nickelodeon&apos;s animated series, <em>Transformers: Earthspark</em>. He plays Cosmos — an Autobot who disguises himself as a carnival ride inspired by <a href="https://www.cinemablend.com/news/1639139/30-best-sci-fi-movies-of-all-time">great sci-fi movies</a> called Cosmic Thunder and can also make himself into a real flying saucer.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="D7dC9twCBbNLeYgRwLp9zA" name="weirdalbatman.jpg" alt="Weird Al and Batman on Batman: The Brave And The Bold" src="https://cdn.mos.cms.futurecdn.net/D7dC9twCBbNLeYgRwLp9zA.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Warner Bros. / DC)</span></figcaption></figure><h2 id="batman-the-brave-and-the-bold-2008-2011">Batman: The Brave And The Bold (2008-2011)</h2><p>"Weird Al" crossed paths with both Batman and Scooby-Doo in the same episode of <em>Batman: The Brave and the Bold</em>, in which Mystery Inc. shows up at his concert, which is soon hijacked by The Joker and The Penguin. He also lends his voice to another segment from Season 2&apos;s "Bat-Mite Presents: Batman&apos;s Strangest Cases!" as jewelry show organizer Mr. Star.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="yndNUdUZ3cqkfXoXKciSsE" name="weirdalfirebuds.jpg" alt="Weird Al Yankovic on FIrebuds" src="https://cdn.mos.cms.futurecdn.net/yndNUdUZ3cqkfXoXKciSsE.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Disney)</span></figcaption></figure><h2 id="firebuds-2022-present-xa0">Firebuds (2022-Present) </h2><p><em>Firebuds</em> is a preschool-level Disney Channel series that combines the heroism of <em>Paw Patrol</em> with the fantasy elements of <em>Cars</em>, following the adventures of children who team up with sentient rescue vehicles. "Weird Al" guest stars as a minivan named Latch, who gets a much-needed boost in confidence from a sing-along session with a musician named Laura (voiced by Lisa Loeb).</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="ix5JTVtJ7sxZUFrQXotBkk" name="weirdallittlebigawesome.jpg" alt="Weird Al Yankovic on Little Big Awesome" src="https://cdn.mos.cms.futurecdn.net/ix5JTVtJ7sxZUFrQXotBkk.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Amazon)</span></figcaption></figure><h2 id="little-big-awesome-2016-2018">Little Big Awesome (2016-2018)</h2><p>"Weird Al" provides both his voice and his face to the role of Mr. Sun in six episodes of Amazon Prime&apos;s children&apos;s program, <em>Little Big Awesome</em>. His first appearance as the personification of the center of the Solar System sees him performing a duet with fellow singer-songwriter Aimee Mann as The Moon.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="KvCHB7NKuTPhcpmiLBigsi" name="weirdal7d.jpg" alt="Weird Al Yankovic on The 7D" src="https://cdn.mos.cms.futurecdn.net/KvCHB7NKuTPhcpmiLBigsi.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Disney)</span></figcaption></figure><h2 id="the-7d-2014-2016">The 7D (2014-2016)</h2><p>Disney Channel&apos;s <em>The 7D</em> is a reimagining of Snow White&apos;s Seven Dwarves as the protectors of the land called Jollywood. In an episode called "Shapeshifter," "Weird Al" guest stars as the dastardly villain of the same name.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="jrTQrH8dWa4wtswQ85b4qa" name="weirdalwanderoveryonder.jpg" alt="Weird Al Yankovic on Wander Over Yonder" src="https://cdn.mos.cms.futurecdn.net/jrTQrH8dWa4wtswQ85b4qa.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Disney)</span></figcaption></figure><h2 id="wander-over-yonder-2013-2016">Wander Over Yonder (2013-2016)</h2><p>One of "Weird Al&apos;s" most bizarre roles (which is really saying something) is Dr. Screwball Jones, whom he voices in two episodes of Disney&apos;s <em>Wander Over Yonder</em>. The sentient banana with clownish rainbow hair has the same goal as the titular hero, Wander, to spread joy, but has more maniacal and borderline villainous ways of doing it.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="GbywjkciKsDodCDXTEN33k" name="weirdalunclegrandpa.jpg" alt="Weird Al Yankovic on Uncle Grandpa" src="https://cdn.mos.cms.futurecdn.net/GbywjkciKsDodCDXTEN33k.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Cartoon Network)</span></figcaption></figure><h2 id="uncle-grandpa-2010-2017">Uncle Grandpa (2010-2017)</h2><p>No one is better suited to play a polka-playing robot than "Weird Al," just as he does in a Season 2 episode of Cartoon Network&apos;s <em>Uncle Grandpa</em> called "Pal.0." However, before the RV&apos;s titular computer system busts out the accordion and grows a wavy hairdo, it goes rogue and tries to make the gang "normal."</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="djXRboPoZk5BZy4d2AFysL" name="weirdalwallykazam.jpg" alt="Weird Al in Wallykazam!" src="https://cdn.mos.cms.futurecdn.net/djXRboPoZk5BZy4d2AFysL.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Nickelodeon)</span></figcaption></figure><h2 id="wallykazam-2014-2017">Wallykazam! (2014-2017)</h2><p>Nickelodeon’s <em>Wallykazam!</em> follows the adventures of a troll named Wally (Thomas Langston) and his pet dragon, Norville (Dan Bittner), who discover the biggest treat in the world while trick-or-treating in an episode called “Mustache Day.” However, in order to get it, they must complete three challenges invented by their neighbor, Wizard Jeff, voiced by “Weird Al,” who also sings a song about underpants in the episode.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="f46Y3dFuepXXiWw4vCQLZF" name="weirdalwebarebears.jpg" alt="Weird Al Yankovic on We Bare Bears" src="https://cdn.mos.cms.futurecdn.net/f46Y3dFuepXXiWw4vCQLZF.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Cartoon Network)</span></figcaption></figure><h2 id="we-bare-bears-2014-2019">We Bare Bears (2014-2019)</h2><p>One of "Weird Al&apos;s" most despicable villain roles comes from Cartoon Network&apos;s <em>We Bare Bears</em>, in which he voices Lewis, who runs a Milk Bottle Knockdown game at a carnival which the bears volunteer to be prizes for. However, when they learn that the game is rigged, meaning no customers will be able to win and adopt them, Grizzly (Eric Edelstein) tries to win their freedom.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="ebZJbg3BAchHCch8XTZjTS" name="weirdalcloseenough.jpg" alt="Weird Al Yankovic on Close Enough" src="https://cdn.mos.cms.futurecdn.net/ebZJbg3BAchHCch8XTZjTS.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Max)</span></figcaption></figure><h2 id="close-enough-2020-2022">Close Enough (2020-2022)</h2><p>In "Weird Al&apos;s" cameo on the Max original animated series, <em>Close Enough</em>, he reveals the secret behind his creative process. It involves sharpening a narwhal tusk, which he then uses to puncture his left foot and use the blood to summon a demon song god named Nishquantazi.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="RiyLCd7qcfKBnvGx6m8am4" name="weirdalbrak.jpg" alt="Weird Al Yankovic on The Brak Show" src="https://cdn.mos.cms.futurecdn.net/RiyLCd7qcfKBnvGx6m8am4.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Adult Swim)</span></figcaption></figure><h2 id="the-brak-show-2000-2007">The Brak Show (2000-2007)</h2><p>On Adult Swim&apos;s <em>The Brak Show</em>, in which the eponymous Space Ghost villain becomes the star of his own family sitcom, Brak&apos;s father (John Lowe) and Thundercleese (Carey Means) become swallowed by a giant worm. There, they meet Petroleum Joe ("Weird Al"), who is a lonely, perverted six-foot-tall monster supposedly made of oil.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="xA9juEteBcu2Zchqc5EUd9" name="weirdalbarnyard.jpg" alt="Weird Al Yankovic on Back at the Barnyard" src="https://cdn.mos.cms.futurecdn.net/xA9juEteBcu2Zchqc5EUd9.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Nickelodeon)</span></figcaption></figure><h2 id="back-at-the-barnyard-2007-2011">Back At The Barnyard (2007-2011)</h2><p>In one episode of Nickelodeon&apos;s series spin-off from <em>Barnyard</em>, <em>Back at the Barnyard</em>, the farm animals plan a heist. Their target turns out to be "Weird Al," who catches them in the act and attacks them with his gold records.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="YHWBYu9e2wxKgqFnPaLGYJ" name="weirdalmad.jpg" alt="Weird Al Yankovic as Superman on Mad" src="https://cdn.mos.cms.futurecdn.net/YHWBYu9e2wxKgqFnPaLGYJ.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Cartoon Network)</span></figcaption></figure><h2 id="mad-2012-2022">Mad (2012-2022)</h2><p>"Weird Al" appears in the 100th episode of Cartoon Network&apos;s <em>Mad</em> — an animated adaptation of the classic comedy magazine — as Superman. He specifically voices <a href="https://www.cinemablend.com/news/2458077/henry-cavills-7-best-superman-moments-so-far">Henry Cavill&apos;s version of the legendary DC Comics character</a> in a spoof of 2013&apos;s <em>Man of Steel</em>.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="uUQPX4PzzuVL7oodPd9tNM" name="weirdalwhereswaldo.jpg" alt="Weird Al Yankovic on Where's Waldo" src="https://cdn.mos.cms.futurecdn.net/uUQPX4PzzuVL7oodPd9tNM.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Peacock)</span></figcaption></figure><h2 id="where-apos-s-waldo-2019-2021">Where&apos;s Waldo (2019-2021)</h2><p>Twice "Weird Al" appears on Peacock&apos;s animated series adaptation of the <em>Where&apos;s Waldo? </em>books as Wizard Artbeard. The character lives up to his name by bearing a long set of whiskers that look as if it has been dipped in every corner of an artist&apos;s palette.</p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ The 100 Best Sitcoms Of All Time, According To CinemaBlend ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/100-best-tv-sitcoms-of-all-time-ranked</link>
                                                                            <description>
                            <![CDATA[ Here's CinemaBlend's rundown of the 100 best sitcoms of all time. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">fQAZPozKT5FnEgVADQGtxS</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/RvRD6bm37P2PCS3dsXm229-1280-80.png" type="image/png" length="0"></enclosure>
                                                                        <pubDate>Sun, 26 May 2024 22:14:26 +0000</pubDate>                                                                                                                                <updated>Mon, 27 May 2024 17:45:00 +0000</updated>
                                                                                                                                            <category><![CDATA[Television]]></category>
                                                                                                                    <dc:creator><![CDATA[ Nick Venable ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/TzeQjfZT5cKqHRsEqudtqT.png ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Nick Venable is an Assistant Managing Editor, and the TV Editor. His humble origin story with CinemaBlend began all the way back in the pre-streaming era, circa 2009, as a freelancing DVD reviewer and TV recapper. After rising up through the ranks covering Movies, Nick leapfrogged over to the small screen to cover more and more television news and interviews, eventually taking over the section for the current era. Born in Louisiana and currently living in Texas — Who Dat Nation over America’s Team all day, all night — Nick spent several years in the hospitality industry, and also worked as a 911 operator. And if you ever happened to hear his music or read his comics/short stories, you have his sympathy. His love for his wife and daughters is almost equaled by his love of gasp-for-breath laughter and gasp-for-breath horror. A lifetime spent in the vicinity of a television screen led to his current dream job, as well as his knowledge of too many TV themes and ad jingles.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What He&#039;s Into&lt;/strong&gt;: Nick is one of those people who won’t necessarily insert a Monty Python reference into every conversation, but is still mentally equipped to do so. Beyond such appreciation for surreal UK comedy, Nick also indulges in as much horror splendor as possible, from Stephen King novels to James Tynion IV comics to Freddy Krueger one-liners to all things Mike Flanagan. Throw in a dash of NFL, some 311 and Weird Al, fried crawfish poboys, bourbon, ‘90s-era pro wrestling, crossword puzzles and mystery-driven video games, and baby, you got a stew going. (Nick will insert an Arrested Development reference into every conversation, if possible.)&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What He&#039;s Excited About&lt;/strong&gt;: Anything Jeff Lemire, Tom King and W. Maxwell Prince think of, ever. More of Kelly Reilly’s deliriously fierce performances on Yellowstone. HBO’s The Last of Us. Clone High’s return. Colin Farrell’s Penguin being in every movie/TV show/breakfast cereal.&lt;/p&gt; ]]></dc:description>
                                                                                                        <dc:contributor><![CDATA[ Cody Beck ]]></dc:contributor>
                                            <dc:contributor><![CDATA[ Adam Holmes ]]></dc:contributor>
                                            <dc:contributor><![CDATA[ Adrienne Jones ]]></dc:contributor>
                                            <dc:contributor><![CDATA[ Alexandra Ramos ]]></dc:contributor>
                                            <dc:contributor><![CDATA[ Corey Chichizola ]]></dc:contributor>
                                            <dc:contributor><![CDATA[ Dirk Libbey ]]></dc:contributor>
                                            <dc:contributor><![CDATA[ Eric Eisenberg ]]></dc:contributor>
                                            <dc:contributor><![CDATA[ Erik Swann ]]></dc:contributor>
                                            <dc:contributor><![CDATA[ Heidi Venable ]]></dc:contributor>
                                            <dc:contributor><![CDATA[ Kelly West ]]></dc:contributor>
                                            <dc:contributor><![CDATA[ Laura Hurley ]]></dc:contributor>
                                            <dc:contributor><![CDATA[ Mick Joest ]]></dc:contributor>
                                            <dc:contributor><![CDATA[ Mike Reyes ]]></dc:contributor>
                                            <dc:contributor><![CDATA[ Philip Sledge ]]></dc:contributor>
                                            <dc:contributor><![CDATA[ Riley Utley ]]></dc:contributor>
                                            <dc:contributor><![CDATA[ Sean O&#039;Connell ]]></dc:contributor>
                                                                    <cf:isSponsored>false</cf:isSponsored>
                <cf:hasAffiliateLinks>false</cf:hasAffiliateLinks>
                <cf:isPaid>false</cf:isPaid>
                                                                                                                                <media:content type="image/png" url="https://cdn.mos.cms.futurecdn.net/RvRD6bm37P2PCS3dsXm229-1280-80.png">
                                                            <media:credit><![CDATA[NBC, CBS, Netflix]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[Lucille Ball, Kelsey Grammer, and Bojack Horseman ]]></media:description>                                                            <media:text><![CDATA[Lucille Ball, Kelsey Grammer, and Bojack Horseman ]]></media:text>
                                <media:title type="plain"><![CDATA[Lucille Ball, Kelsey Grammer, and Bojack Horseman ]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/RvRD6bm37P2PCS3dsXm229-1280-80.png" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>Though television programming existed in various forms for more than a decade before the first situation comedies officially arrived in the late 1940s, the sitcom quickly became one of the most popular and duplicated genres for the next 80+ years. From stand-up comics to Hollywood icons, sitcoms are responsible for some of pop culture’s biggest stars, from Jerry Seinfeld to Jennifer Aniston to Dick Van Dyke to Lucille Ball, as well as <a href="https://www.cinemablend.com/television/classic-tv-catchphrases-and-the-story-behind-them"><u>some of the most memorable catchphrases</u></a>.</p><p>Despite <a href="https://www.cinemablend.com/television/abbott-elementary-only-comedy-abc-fall-line-up-other-shows-canceled-im-worried-about-future-of-sitcoms"><u>broadcast networks no longer championing sitcoms as much</u></a> as in years past, with streaming services picking up the slack — Netflix is now more known for multi-camera sitcoms than any of the Big 4 —  TV comedies will likely continue to keep audiences breathless with laughter for many more years to come. As such, CinemaBlend’s staff came together to celebrate and rank the 100 best sitcoms of all time, with the order stemming partially from our writers’ sharing scores for more than 200 different series, along with other contributing factors.</p><p>So sit back in your favorite recliner, grab an extra-large Squishee (or an ice-cold Duff, if you’re of age) and settle into the coziness, comfort, and occasional cringeworthiness of the best TV sitcoms of all time, according to CinemaBlend.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="puaNzErn66Eon3Cmtz633" name="" alt="Dick York and Elizabeth Montgomery on Bewitched" src="https://cdn.mos.cms.futurecdn.net/puaNzErn66Eon3Cmtz633.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><h2 id="100-bewitched">100. Bewitched</h2><p>You know a show is a classic when even <a href="https://www.cinemablend.com/interviews/wandavision-was-inspired-by-bewitched-but-it-turns-out-the-marvel-series-also-used-something-very-important-from-the-classic-tv-program"><u>Marvel is drawing inspiration</u></a> from it nearly 50 years after its end. The fantasy sitcom <em>Bewitched</em> worked its magic at CBS for eight seasons, partially due to the phenomenal comedic acting of Elizabeth Montgomery and Dick York, who was <a href="https://www.cinemablend.com/television/the-story-behind-bewitcheds-two-darrins"><u>famously replaced by Dick Sargent</u></a> due to York's worsening health issues. Add in an equally impressive ensemble cast including Agnes Moorehead, David White, and Paul Lynde (just to name a few), and it's no wonder <em>Bewitched</em> was a nose-twitching delight of a show that doesn't need supernatural abilities to be great.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="iivmqkhu2Vashid8cXiNz9" name="" alt="Penny Marshall and Cindy Williams on Laverne & Shirley" src="https://cdn.mos.cms.futurecdn.net/iivmqkhu2Vashid8cXiNz9.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><h2 id="99-laverne-and-shirley">99. Laverne and Shirley</h2><p>Arguably the most successful <em>Happy Days</em> spinoff, as well as one of the best TV comedies of all time, <em>Laverne & Shirley</em> followed two best friends and bottle-cappers as they navigated life and everything it threw at them in Milwaukee, Wisconsin (later Burbank, California). Though similar in tone to its predecessor, this long-running sitcom relied more on the physical comedy talents masterfully pulled by stars Penny Marshall and Cindy Williams. And when it comes to iconic opening credits sequences, <em>Laverne & Shirley</em> was in a league of its own with all those shots of the fictional Shotz Brewery along with that classic theme.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="uuSLas3FtkqdfbRhX2FH65" name="" alt="Beavis and Butt-head headbanging on the couch" src="https://cdn.mos.cms.futurecdn.net/uuSLas3FtkqdfbRhX2FH65.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Paramount+)</span></figcaption></figure><h2 id="98-beavis-and-butt-head">98. Beavis And Butt-Head</h2><p>No <em>Beavis And Butt-Head</em> fan will argue that the show isn’t dumb. Because it is. It really, really is, in each of its iterations. The two eponymous characters rank as two of the most unambiguously stupid protagonists to ever grace a TV screen, and every word they say is unadulterated idiocy. Ironically, though, that’s the genius of Mike Judge’s creation. The impossibly dumb leads allow for stories that no other sitcom can reasonably or responsibly touch with any degree of verisimilitude, while also permitting some outrageously weird takes on music videos (and social clips) across various eras.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="dssiiXGDrmbdsnL8MTwtn3" name="" alt="Bob Crane as Colonel Robert Hogan, Werner Klemperer as Colonel Wilhelm Klink in the HOGAN'S HEROES episode, "Is General Hammerschlag Burning?" Episode aired November 18, 1967." src="https://cdn.mos.cms.futurecdn.net/dssiiXGDrmbdsnL8MTwtn3.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Getty Images/ CBS Photo Archive / Contributor)</span></figcaption></figure><h2 id="97-hogan-39-s-heroes">97. Hogan's Heroes</h2><p>War stories are often suited for prestige dramas, but <em>Hogan's Heroes</em> proved that a P.O.W. camp comedy could be just as awards-worthy. During its 168-episode run, Bob Crane's titular leader and his squad constantly thwarted Nazi enemies with fast-talking and constant hijinks (many of which were put into play by future game show legend Richard Dawson). Lasting as long as World War II did itself, <em>Hogan's Heroes</em> showcased how reflecting on past tragedies with humor can make for memorable art.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="tyC2HtPo2qKtLfpzEP6fA8" name="" alt="Ashley Williams and Josh Radnor on How I Met Your Mother" src="https://cdn.mos.cms.futurecdn.net/tyC2HtPo2qKtLfpzEP6fA8.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBS)</span></figcaption></figure><h2 id="96-how-i-met-your-mother">96. How I Met Your Mother</h2><p><em>How I Met Your Mother</em> may be higher on this list if not for fan opinions of the final season, but I would 100% say that it’s worth watching despite a lackluster ending. This show is about finding out how Josh Radnor’s Ted met his future wife, but it really thrives as a series about best friends. As Neil Patrick Harris’ Barney Stinson would say, this ensemble is legen–wait for it–dary, and those who check it out will definitely be invested in<a href="https://www.cinemablend.com/television/2474932/how-i-met-your-mother-whats-the-cast-up-to-now"> <u>what the cast is doing now</u></a> that the series is over. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="H3VTMMenwYHoDrSmem5ay6" name="" alt="Pam Dawber and Robin Williams on Mork & Mindy" src="https://cdn.mos.cms.futurecdn.net/H3VTMMenwYHoDrSmem5ay6.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><h2 id="95-mork-amp-mindy">95. Mork & Mindy</h2><p>Today we all know what an immense talent Robin Williams was, and the absolutely wild places he could take comedy. Imagine not knowing any of that, and then turning on an early episode of <em>Mork & Mindy</em>, where he must have come across quite like somebody from another world, much like the character he played. Mork from Ork gave Williams the freedom to do almost anything on screen opposite Pam Dawber’s Mindy (and later Jonathan Winters), and it’s no surprise he took over Hollywood after four successful seasons.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="S2igrCEqpopuPbmaNU9Brf" name="" alt="Michael C. Maronna in The Adventures of Pete and Pete" src="https://cdn.mos.cms.futurecdn.net/S2igrCEqpopuPbmaNU9Brf.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Nickelodeon)</span></figcaption></figure><h2 id="94-the-adventures-of-pete-and-pete">94. The Adventures of Pete and Pete</h2><p>Plenty of shows focus on the weirdness of suburbia, but Nickelodeon’s <em>The Adventures of Pete & Pete</em> still stands awkwardly as one of the best. As Older Pete (Michael Maronna) and Younger Pete (Danny Tamberelli) navigate the oddities of Wellsville, life lessons and warm memories are gifted to viewers  by creators Will McRobb and Chris Viscardi. <em>Pete & Pete</em> delivers its homespun  tales with a deep-seated love of ‘50s and ‘60s pop culture, and with one of the more impressive celebrity guest star rosters of kid-centric TV. Where else will you find REM’s Michael Stipe as a conspiratorial ice cream man?</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="e69De9Ud8Zn5UtZQdqNnE6" name="" alt="The main stars of Black-ish, which Gail Lerner has produced for several seasons." src="https://cdn.mos.cms.futurecdn.net/e69De9Ud8Zn5UtZQdqNnE6.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><h2 id="93-black-ish">93. black-ish</h2><p>Watching Anthony Anderson and Tracee Ellis Ross’ Andre and Rainbow Johnson raise their family amidst navigating various challenges in and around their largely white-populated neighborhood, all while still hanging onto their Black identities, makes for eight seasons of exceptional sitcom storytelling. While <em>black-ish</em> went on to launch two spinoffs, the original still stands as the cream of the crop, expertly balancing pointed social commentary and humor regarding a variety of topics, racial and otherwise. Plus, TV grandfather-dom looks great on Laurence Fishburne.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="53AhhdDoosPTCmCzzCM8y6" name="" alt="Fred and Grandpa in The Munsters" src="https://cdn.mos.cms.futurecdn.net/53AhhdDoosPTCmCzzCM8y6.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: YouTube)</span></figcaption></figure><h2 id="92-the-munsters">92. The Munsters</h2><p>What happens when a family largely modeled after Universal’s Classic Monsters takes up residence in the middle of suburban America’s Mockingbird Heights? You get <em>The Munsters</em>, which slotted in nicely among other comedic offerings in the ‘60s while also satirizing sitcom tropes of the era. Although Fred Gwynne’s bumbling patriarch Herman was often the driving force behind the weekly shenanigans, Lily, Grandpa, Eddie and Marilyn (the only “normal” looking one) were all far more endearing than their monstrous counterparts, making <em>The Munsters</em> a great platform for chaotic, yet heartfelt entertainment.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="8MC2siMWAy3SjLJ3tKuxRN" name="" alt="Casey Wilson and Eliza Coupe in Happy Endings" src="https://cdn.mos.cms.futurecdn.net/8MC2siMWAy3SjLJ3tKuxRN.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><h2 id="91-happy-endings">91. Happy Endings</h2><p>Best friends are always good sitcom fodder, as David Caspe’s <em>Happy Endings</em> proved for three seasons on ABC ahead of its fan-angering cancellation. Damon Wayans Jr.’s cucumber-cool Brad and Eliza Coupe’s A-type Jane are the group’s PDA-friendly couple, while her sister, Elisha Cuthbert’s confusion-prone Alex, is exes-ish with Zachary Knighton’s dorky-smooth Dave. The group is rounded out by Adam Pally’s schlubbo-sexual Max and Casey Wilson’s serial dater Penny. Perhaps the only sitcom whose leads share a fictional history as <em>Real World</em> vets, <em>Happy Endings</em> is as fun and fancy-free as romance-fueled sitcoms get.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="AYESJZcdjfvnkVXqCMtYum" name="" alt="Ellie Kemper in Unbreakable Kimmy Schmidt." src="https://cdn.mos.cms.futurecdn.net/AYESJZcdjfvnkVXqCMtYum.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="90-unbreakable-kimmy-schmidt">90. Unbreakable Kimmy Schmidt</h2><p>Less than two years after Ellie Kemper played Erin Hannon for the last time on <em>The Office</em>, she sunshine-smiled her way through a bonkers show of her own with Netflix’s original <em>Unbreakable Kimmy Schmidt</em>. The series, which centered on former cult member Kimmy’s surreal and gung-ho acclimation to life in a “real” world she hadn’t lived in for years. One of the more unique shows from creators Tina Fey and Robert Carlock, <em>Kimmy</em> could have made this list just for turning the multi-talent Tituss Burgess into a small-screen regular. Extra kudos for the follow-up movie <em>Kimmy vs the Reverend</em>.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="ZubTLEicu82yop9MnXfBcf" name="" alt="Ashton Kutcher and Mila Kunis on That '70s Show" src="https://cdn.mos.cms.futurecdn.net/ZubTLEicu82yop9MnXfBcf.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: The Carsey-Werner Company)</span></figcaption></figure><h2 id="89-that-39-70s-show">89. That '70s Show</h2><p>Starring Topher Grace and running for eight seasons from 1998-2006, <em>That ‘70s Show</em> transports any generational audience who watches back to the late 1970s for the horned-up (and oh-so-slightly drugged-up) exploits of high school besties and their respective parents. The teens were played by actors who would go on to become bona fide stars, including Ashton Kutcher, Mila Kunis, Wilmer Valderrama, and Laura Prepon. The Circle in Eric’s basement was always reliable for big laughs, and though its final season suffered from cast exits, Netflix’s <em>That ‘90s Show</em> kept the good times going far more successfully than <em>That ‘80s Show</em>.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="LRvKeyB7quRnUDuADsaMhT" name="" alt="Ashley Jensen and Ricky Gervais on Extras" src="https://cdn.mos.cms.futurecdn.net/LRvKeyB7quRnUDuADsaMhT.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: BBC/HBO)</span></figcaption></figure><h2 id="88-extras">88. Extras</h2><p>Ricky Gervais and Steven Merchant followed up on the smash success of <em>The Office</em> by crossing the ocean to HBO for the Hollywood-skewing riot <em>Extras</em>, which hinged on the fraught character trifecta of Gervais’ dispirited actor Andy, his god-awful agent Darren (Merchant) and his kind-hearted and oblivious actress BFF Maggie (Ashley Jensen). While only two seasons and a Christmas special, it’s a modern classic not only for its gloriously cornball faux sitcom <em>When the Whistle Blows</em>, but for bonkers celebrity cameos from Kate Winslet, Patrick Stewart, Ian McKellan and more. Gervais also delivers an all-time Top 5 spit-take in one episode. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="QYbgPLe443hm3ZzBXNpvCD" name="" alt="Bernie Mac in The Bernie Mac Show" src="https://cdn.mos.cms.futurecdn.net/QYbgPLe443hm3ZzBXNpvCD.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Fox)</span></figcaption></figure><h2 id="87-the-bernie-mac-show">87. The Bernie Mac Show</h2><p>The late Bernie Mac is still widely viewed as a comedy giant, and his eponymous family sitcom is a major reason for that. <em>The Bernie Mac Show</em> definitely isn’t the first comedy to be headlined by a stand-up, but it’s one of the few that so perfectly utilized the talents of its lead. Mac’s signature brand of no-nonsense humor is especially hilarious when he bounces off his A+ co-stars. But, overall, what makes this series one of the <a href="https://www.cinemablend.com/television/2547929/black-ish-and-11-other-great-black-sitcoms-from-the-past-20-years"><u>great modern Black sitcoms</u></a> is its funny, warm and nuanced depiction of familial dynamics amongst African Americans.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="9Nx7G97H2qa4Fzr2obBwd7" name="" alt="Bob Denver on Gilligan's Island" src="https://cdn.mos.cms.futurecdn.net/9Nx7G97H2qa4Fzr2obBwd7.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBS)</span></figcaption></figure><h2 id="86-gilligan-39-s-island">86. Gilligan's Island</h2><p>Before <em>The Brady Bunch</em> (but after <em>The Red Skelton Show</em>), screenwriter and producer Sherwood Schwartz launched 1964's smash-hit <em>Gilligan's Island</em>, and the fictional voyage was far more doomed than the show's. Starring Bob Denver and Alan Hale, the sitcom won over viewers with plots hinged on island inventions, unexpected visitors, dream sequences, and random items washing up ashore. While the show <a href="https://www.cinemablend.com/television/famous-sitcoms-that-never-made-it-to-100-episodes"><u>famously never hit one hundred episodes</u></a>, its premise was beloved enough to spark several TV movies and the truly baffling Saturday morning cartoon spinoff <em>Gilligan's Planet</em>. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="KvDd8TeZTCu29Mu2kv7Btg" name="" alt="Helen Hunt and Paul Reiser on Mad About You" src="https://cdn.mos.cms.futurecdn.net/KvDd8TeZTCu29Mu2kv7Btg.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="85-mad-about-you">85. Mad About You</h2><p>Chemistry is usually all it takes to keep a sitcom afloat, whether its shared by an ensemble (see: <em>Friends</em>) or tethered to a winning duo like Paul Reiser and Helen Hunt in <em>Mad About You</em>. It helps that both actors lent their movie-level wattage to the sitcom for eight seasons, exploring marriage and eventually parenthood in New York City. (Reiser previously co-starred in <em>My Two Dads</em>, to be sure.) But despite the parade of stellar comedic co-stars — Hank Azaria, Lisa Kudrow, Carol Burnett, and Mel Brooks? Come on! — it was Paul and Jamie keeping us invested. We were mad about them, and maybe a different kind of mad about Mabel.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="kqZu8Nd6j3Uju5PbiRuKC7" name="" alt="The original Three's Company cast" src="https://cdn.mos.cms.futurecdn.net/kqZu8Nd6j3Uju5PbiRuKC7.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><h2 id="84-three-39-s-company">84. Three's Company</h2><p><em>Three’s Company</em> is an interesting case-study in dated sitcom writing, as 90% of the jokes that prop up the show wouldn’t fly today. Almost every single line can be construed as sexual innuendo, and the plot twists of a given <em>Three’s Company</em> episode are so driven by silly miscommunications, the formula is basically cliche. However, John Ritter’s deep reservoir of charm, when combined with his incredible chemistry with the female roommates that came in and out of his orbit, made it an overall win, and one of the most memorable and breezy sitcoms of the 1970s and ‘80s.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="y35xoEqVpURkXuiiRpNLJF" name="" alt="The Griffin family sitting on a couch" src="https://cdn.mos.cms.futurecdn.net/y35xoEqVpURkXuiiRpNLJF.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Fox)</span></figcaption></figure><h2 id="83-family-guy">83. Family Guy</h2><p>What can be said about <em>Family Guy</em> that hasn’t already been said? While Seth MacFarlane’s first mega-hit doesn’t feel quite as crude as other late night animated fare these days, it quickly cemented itself as an envelope-pushing primetime entry thanks to its murderous baby, they hyper-perverse Quagmire, and the less said about Herbert, the better. The series made a meme-worthy artform out of cutaway gags, man vs. chicken fights and lowbrow pop culture spoofs. At this point, the Griffins are basically as widespread as the Simpsons, and Brian would certainly drink to that. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="dQ6ebn2hZV8ynsPRLxQMZJ" name="" alt="Frankie Muniz, Jane Kaczmarek, and Justin Tyler Berfield in Malcolm in the Middle" src="https://cdn.mos.cms.futurecdn.net/dQ6ebn2hZV8ynsPRLxQMZJ.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Fox)</span></figcaption></figure><h2 id="82-malcolm-in-the-middle">82. Malcolm In The Middle</h2><p><em>Malcolm in the Middle</em> was a key part of Fox’s Sunday comedy lineup for six of its seven seasons from 2000-2006. At the time, the Frankie Muniz-starring comedy was a rare example of a single-camera sitcom that eschewed a laugh track and had its lead regularly breaking the fourth wall. The family was known to deal with serious issues in the background of the shenanigans of the sibling trio, which helped the sitcom win seven Emmys. It was also Bryan Cranston’s breakout primetime TV role, proving he was a comedy legend years before dipping into drama for <em>Breaking Bad</em>.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="zHFz2qGJLAws3YgYYqimC7" name="" alt="Mrs Garrett, Tootie, Jo and Natalie around table in The Facts of Life" src="https://cdn.mos.cms.futurecdn.net/zHFz2qGJLAws3YgYYqimC7.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: YouTube)</span></figcaption></figure><h2 id="81-the-facts-of-life">81. The Facts Of Life</h2><p>A spinoff of <em>Diff’rent Strokes</em>, <em>The Facts of Life</em> is one of the most successful TV offshoots that shares little with its predecessor, and for good reason. The coming-of-age sitcom explores adolescence in a way that neither its predecessor nor follow-up projects ever could, with a perfectly cast ensemble of young actresses led by the incomparable Charlotte Rae. This sitcom exists because of Rae’s previously stellar work, and her warmth and charm in the role of Mrs. Garrett helped make a family out of her girls, from Natalie to Tootie to Jo to Blair and the rest.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="EexeMhZw2EicRBMksgRRaR" name="" alt="John Astin and Carolyn Jones in The Addams Family" src="https://cdn.mos.cms.futurecdn.net/EexeMhZw2EicRBMksgRRaR.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: MGM Television)</span></figcaption></figure><h2 id="80-the-addams-family">80. The Addams Family</h2><p>Although <em>The Addams Family</em> started off as a single-panel <em>New Yorker</em> comic strip published from 1938 to 1964, it was the TV series premiering that same latter year which made the family a pop culture favorite. Watching Morticia, Gomez, Uncle Fester, Wednesday, Pugsley, Grandmama, Lurch and Thing freak people out with their macabre tastes and supernatural antics never got old, and without the popularity of this show, it’s doubtful these ghoulish characters would have returned in a variety of live-action and animated projects in later years. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="9xuGCkAcksSvJzADT6rXxB" name="" alt="Jason Lee as Earl Hickey on My Name Is Earl" src="https://cdn.mos.cms.futurecdn.net/9xuGCkAcksSvJzADT6rXxB.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="79-my-name-is-earl">79. My Name Is Earl</h2><p><em>My Name Is Earl</em> earned its way to sitcom greatness thanks to star Jason Lee’s all-in performance as Earl Hickey, as well as the great premise that sees Earl attempting to right the litany of past wrongs committed against seemingly everyone he’d ever met. (The concept also helps make it easy to drop in on any random episode without <em>really</em> needing to see what happened beforehand.) Ethan Suplee, Eddie Steeples and Jaime Pressley are equally brilliant in their respective roles, and we can still relate to <em>Earl</em> to this day anytime we struggle to keep our eyes open while taking a picture.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="Pi6ic5jMZKWtAJjEogVksN" name="" alt="the heck family on the middle" src="https://cdn.mos.cms.futurecdn.net/Pi6ic5jMZKWtAJjEogVksN.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><h2 id="78-the-middle">78. The Middle</h2><p>Every once in awhile, a show sneaks it way into the zeitgeist and in our memories. <em>The Middle</em>, a show about a quirky middle-class family from the Midwest ran for nine years and hit home for a wide and nostalgic audience. It was a breath of fresh air and an honest take on class and what it was really like to grow up in, well, “the middle” of everything. Ironically, it was the <a href="https://www.cinemablend.com/television/why-the-endingthe-middle-was-perfect-according-patricia-heaton">ending of the show that stuck with most</a>, but all good things must come to an end. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="KpCnbKaZswYWzHFhsXQjWk" name="" alt="Lil Dicky on DAVE" src="https://cdn.mos.cms.futurecdn.net/KpCnbKaZswYWzHFhsXQjWk.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: FX)</span></figcaption></figure><h2 id="77-dave">77. Dave</h2><p>This whole entry could be spent talking about how <em>Dave</em> is driven by the exceptional talent of David “Lil Dicky” Burd, who has a truly offbeat world perspective to go along with his legitimate gifts as a rapper. But that would be a disservice to Davionte "GaTa" Ganter, who proves over the course of the three seasons to be the NSFW series’ true heart. It gets funny and ridiculous, but it can also deliver a nice, solid gut punch courtesy of your investment in the characters’ plights for recognition. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="ZqSXqVNnesFzEPxZh6iyeb" name="" alt="Michael J. Fox in Spin City." src="https://cdn.mos.cms.futurecdn.net/ZqSXqVNnesFzEPxZh6iyeb.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><h2 id="76-spin-city">76. Spin City</h2><p>Arguably TV's least polarizing political sitcom, <em>Spin City</em> was a winning candidate for its six-season term in part due to co-creators Bill Lawrence and Gary David Goldberg. The latter also created <em>Family Ties</em>, and brought Michael J. Fox into the lead role here as well, with Charlie Sheen successfully taking over in Season 5 after Fox's medical-related exit  <em>Spin City</em> is also a melting pot of TV excellence, boasting Connie Britton, Carla Gugino, Richard Kind, Alan Ruck and more greats filling out the NYC mayor’s office.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="oWgSXKfVK6pLALCinUm4sL" name="" alt="Andy Griffith on Andy Griffith Show" src="https://cdn.mos.cms.futurecdn.net/oWgSXKfVK6pLALCinUm4sL.jpeg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBS )</span></figcaption></figure><h2 id="75-the-andy-griffith-show">75. The Andy Griffith Show</h2><p>One of the most iconic and wholesome sitcoms of the 20th century, <em>The Andy Griffith Show</em> gave audiences nearly 250 episodes with the residents of the fictional town of Mayberry, North Carolina, centering on local sheriff Andy Taylor, played with aw-shucks charm by Griffith. Characters like Barney Fife (Don Knotts), Gomer Pyle (Jim Nabors), Aunt Bee (Frances Bavier), and Opie (a young Ron Howard) made for plenty of the early highlights in sitcom history, both in black-and-white and color. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="SsL3fD7ZYrNKiB2A369GWh" name="" alt="Steve Urkel and Carl sitting on the couch in Family Matters" src="https://cdn.mos.cms.futurecdn.net/SsL3fD7ZYrNKiB2A369GWh.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: HBO Max)</span></figcaption></figure><h2 id="74-family-matters">74. Family Matters</h2><p>Airing for nine seasons from 1989-1997, <em>Family Matters</em> became a beloved sitcom for multiple generations regularly tuning into ABC’s TGIF lineup. The spinoff of <em>Perfect Strangers</em> followed the highs and lows of the Winslow family, with <em>Die Hard</em> vet Reginald VelJohnson becoming an iconic sitcom dad as Carl Winslow. Of course, Jaleel White’s Steve Urkel famously stole the spotlight as the nerd-tastic breakout star, sporting the signature “Did I do that?” catchphrase. Yes, he certainly did, if by “that” he meant annoying his unrequited love Laura or creating alternate versions of himself via sitcom science.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="ufxEukARm5mWdn6dNMCqhF" name="" alt="The Wonder Years" src="https://cdn.mos.cms.futurecdn.net/ufxEukARm5mWdn6dNMCqhF.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><h2 id="73-the-wonder-years">73. The Wonder Years</h2><p><em>The Wonder Years</em> aired from 1988-1993, but very fathfully recreated the late ‘60s and early ‘70s to invite audiences into the lives of the Arnold family. Starring Fred Savage in his breakout role (alongside fellow greats Dan Lauria, Alley Mills, and Danica McKellar), the coming-of-age comedy touched on Vietnam War politics, high school romance, deaths of loved ones, sibling rivalries and more, with Daniel Stern's narration a key source of its charm and emotional heft. From using Joe Cocker’s unforgettable “With a Little Help from My Friends” to its powerful-yet-unplanned finale, it’s no wonder that this classic eventually inspired a reboot.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="vDPGsqpz2aexUpePxhSrFj" name="" alt="The Flintstones in their fly mobile" src="https://cdn.mos.cms.futurecdn.net/vDPGsqpz2aexUpePxhSrFj.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Hanna-Barbera Productions)</span></figcaption></figure><h2 id="72-the-flintstones">72. The Flintstones</h2><p><em>The Flintstones</em> is arguably the first animated project to prove itself as much of a classic sitcom as anything in live-action. Premiering back in 1960 and running for six wildly successful seasons, the sitcom follows the titular family within a fictional and idealized version of the Stone Age. Its popularity kept it airing in syndication for decades,later inspiring spinoffs, live-action movies, TV specials, ice cream pops, and (of course) the most memorable vitamins down the medicine aisle. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="JnEkgassVk8yqhxb8sip6Z" name="" alt="The entire Proud Family sitting on the couch together." src="https://cdn.mos.cms.futurecdn.net/JnEkgassVk8yqhxb8sip6Z.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Disney Channel)</span></figcaption></figure><h2 id="71-the-proud-family">71. The Proud Family</h2><p><em>The Proud Family</em> was one of the standout shows of ABC’s One Saturday Morning programming block, walking the line between cartoony kids show and legitimate family drama quite well. Disney+’s more recent <em>Louder And Prouder</em> revival is evidence of that popularity and storytelling skills. Kyla Pratt’s Penny Proud is as relatable a TV teen as can be, and Sugar Mama (voiced by <em>Family Matters</em>’ Jo Marie Payton) is the kind of grandmother anyone would appreciate, sans bodyslams. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="sqaiLhcwGuBzQudcXrpEGW" name="" alt="The Drew Carey Show cast raises fists in happiness." src="https://cdn.mos.cms.futurecdn.net/sqaiLhcwGuBzQudcXrpEGW.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Warner Bros. Television)</span></figcaption></figure><h2 id="70-the-drew-carey-show">70. The Drew Carey Show</h2><p>Long before he became host of <em>The Price is Right,</em> Drew Carey jumped from standup comedy to sitcom stardom with <em>The Drew Carey Show</em>, which ran for nine increasingly zany seasons from 1995-2004. The comedian starred as a fictionalized version of himself living in Ohio, working at a mundane job surrounded by a core group of friends with hijinks to spare. (Particularly during the A+ April Fool’s Day episodes.) This was the first big scripted TV role for cast members like Christa Miller, Diedrich Baker, Ryan Stiles, Craig Ferguson, and John Carroll Lynch. Hopefully fans can agree with the show on one thing: Cleveland Rocks! </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="icxdpwjGBWtAPX3YbWataM" name="" alt="the cast of designing women" src="https://cdn.mos.cms.futurecdn.net/icxdpwjGBWtAPX3YbWataM.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBS)</span></figcaption></figure><h2 id="69-designing-women">69. Designing Women</h2><p>If watching four sassy, professional ladies flourish, flounder, and tell it like it is sounds like something you can get behind, then look no further than <em>Designing Women</em>. The comedy starred the all-time great cast of Dixie Carter, <em>Young Sheldon’</em>s Annie Potts, Delta Burke and <em>Hacks</em> star Jean Smart as co-workers sharing their personal and professional trials and triumphs to side-splitting effect over several seasons. Even better, the show managed to work in a lot of social commentary that’s still relevant today, and no one has ever taken down bullies and bigots like Carter’s Julia Sugarbaker.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="8WPUxhThvfVkT7TVZUoQjB" name="" alt="Dan Fielding adjusting his tie, standing between Harry Stone and Christine Sullivan" src="https://cdn.mos.cms.futurecdn.net/8WPUxhThvfVkT7TVZUoQjB.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Prime Video)</span></figcaption></figure><h2 id="68-night-court">68. Night Court</h2><p>Many sitcoms can be vehicles for a single great comedian to shine, but the strength of the original <em>Night Court</em> was its ensemble. (And that sax-y theme.) Harry Anderson played de facto leader Judge Harry Stone alongside John Laroquette, Markie Post, Richard Moll and more, and the jury of TV audiences gave the verdict of <em>Night Court</em> being guilty of hilarity. Despite the fact that the show’s format could seem as formulaic as real-life courtroom dockets, silliness often ensued, and fans were happy to watch these talents play off each other for an enviable nine-season run. Its popularity endures with Melissa Rauch’s 2023 revival.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="LfFiGvnzmAiVpGVJgKATNe" name="" alt="Alice Kramden and her husband in The Honeymooners." src="https://cdn.mos.cms.futurecdn.net/LfFiGvnzmAiVpGVJgKATNe.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBS)</span></figcaption></figure><h2 id="67-the-honeymooners">67. The Honeymooners</h2><p>TV shows have a way of changing the pop culture landscape by being quotable, and <em>The Honeymooners</em> is one of the earliest sitcoms whose influence is definitely still felt  in that category, with “One of these days Alice…” and “To the moon!” persisting so many decades later. The all-time classic follows two New York City couples and the various shenanigans they get into, with Ralph and Alice famously played by Jackie Gleason and Audrey Meadows, respectively. And while the empty threats of domestic violence might be jarring for newcomers, <em>The Honeymooners</em> significantly set the stage for so many sitcoms to follow.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="8xwwDps57rHPZR7VYoeqR6" name="" alt="Martha Plimpton and Garret Dillahunt in Raising Hope" src="https://cdn.mos.cms.futurecdn.net/8xwwDps57rHPZR7VYoeqR6.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Fox)</span></figcaption></figure><h2 id="66-raising-hope">66. Raising Hope</h2><p>Wacky isn’t always a word that comes up when discussing family sitcoms, but <em>Raising Hope</em> fits that description to a T. The Chance family is filled with more lovable and well-meaning weirdos than you’d think could possibly fit into half-hour eps, but they all have their odd (and potentially relatable) quirks. From dad Burt (who picks his nose by using all 10 fingers), to matriarch Maw Maw (who can frequently be found shirtless and/or braless and giving off old people smells), you’d be hard-pressed to land on an episode that doesn’t make you choke on your big dill pickle.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="wYsd3PKvRXsfvt8XQFtZzM" name="" alt="the cast of fresh off the boat" src="https://cdn.mos.cms.futurecdn.net/wYsd3PKvRXsfvt8XQFtZzM.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><h2 id="65-fresh-off-the-boat">65. Fresh Off The Boat</h2><p>Everyone loves a good family sitcom, and while <em>Fresh Off the Boat</em> is technically about the young, hip-hop-obsessed son within a Taiwanese-American family in Orlando, the real comedic meat of the show is his mom, Jessica (Constance Wu). We’ve never seen a mom like Jessica Huang before. Yes, she’s loving, but it’s an absurdly tough, uncompromising love that pushes her nice, America-loving husband and three sons to excel. She’s also fiercely competitive and not someone to mess with, which diners-and-dashers can attest to, and is a big reason why <em>Fresh Off the Boat</em> will always be watchable.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="BEWc6C6PCA4g9sBzYkfuRL" name="" alt="Julian, Chris at dinner table in Everybody Hates Chris" src="https://cdn.mos.cms.futurecdn.net/BEWc6C6PCA4g9sBzYkfuRL.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: The CW)</span></figcaption></figure><h2 id="64-everybody-hates-chris">64. Everybody Hates Chris</h2><p><em>Abbott Elementary</em> fans can attest to Tyler James Williams’ comedic chops, but he first honed them from his younger Hollywood days as the star of <em>Everybody Hates Chris</em>. Created by Chris Rock (who narrates) and Ali LeRoi, the show is based on the stand-up legend’s teenage years, and finds ways of making everyday occurrences the most hilarious things in the world, often landing a wide-eyed Chris in trouble. From James’ impressive performance as a teenager to the rest of the cast (including a stellar Terry Crews’ dad mode), <em>Everybody Hates Chris</em> is a must-watch for comedy lovers of all ages.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="6KMFyUZXbGPxP9uFnqeA8f" name="" alt="Barbara Feldon and Don Adams on Get Smart" src="https://cdn.mos.cms.futurecdn.net/6KMFyUZXbGPxP9uFnqeA8f.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBS)</span></figcaption></figure><h2 id="63-get-smart">63. Get Smart</h2><p>Secret agent movies were big in the 1960s, so how could one go wrong with a spoof comedy series created by Mel Brooks and Buck Henry? <em>Get Smart</em> stars Don Adams’ Maxwell Smart (aka the bumbling CONTROL Agent 86) often teaming up with Barbara Feldon’s<a href="https://www.cinemablend.com/movies/movie-and-tv-sidekicks-we-love-as-much-as-the-lead-character"> <u>more-than-capable sidekick</u></a>, Agent 99, to thwart the evil, if not entirely professional, efforts of the cabal KAOS. From the series’ iconic opening credits to Max’s shoe phone, <em>Get Smart</em> stands the test of time, with some great catchphrases to boot, including “MIssed it by that much,” and, “Would you believe…?”</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="LsXPg7PuuaWsiAdEYxZdCf" name="" alt="Krysten Ritter and James Van Der Beek on Don’t Trust The B**** In Apartment 23" src="https://cdn.mos.cms.futurecdn.net/LsXPg7PuuaWsiAdEYxZdCf.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><h2 id="62-don-39-t-trust-the-b-in-apartment-23">62. Don't Trust the B---- in Apartment 23</h2><p>We sometimes wonder how well creator Nahnatchka Khan’s <em>Don’t Trust the B—- in Apartment 23</em> would have fared if it lasted beyond its celebrated two-season run. And we wish we were given the chance to actually see that hypothetical third season for ourselves, as the 26 episodes we did get were spot on. Pairing Dreama Walker’s naive June with Krysten Ritter’s scheming Chloe made for an odd couple who knew how to have exciting adventures. Frequent appearances by an early-career Eric André and an always charming James Van Der Beek only made this ABC series all the sweeter.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="XumAv4F7Ecz4sATgNbmhWN" name="" alt="J.J. in Good Times." src="https://cdn.mos.cms.futurecdn.net/XumAv4F7Ecz4sATgNbmhWN.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBS)</span></figcaption></figure><h2 id="61-good-times">61. Good Times</h2><p>A quality sitcom spinoff can be a challenge. Repeat what worked on the original, or try to do something totally different? <em>Good Times</em> spun off from <em>Maude</em> (which itself was an <em>All In The Family</em> offshoot), and succeeded through carving out its own authentic niche centering around the hard-working and cash-strapped characters of Florida (Esther Rolle) and James Evans (John Amos). The two leads were excellent throughout, though <em>Good Times</em> eventually shifted its primary focus to Jimmie Walker, the sitcom’s breakout star who coined the phrase “Dynomite!” and rode that marketing freight train to global superstardom. A series that lives up to its name, and then some.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="tYCG5vcw2v3d4HCPptJhWj" name="" alt="Fran Fine applying to be the Sheffields' nanny in The Nanny pilot." src="https://cdn.mos.cms.futurecdn.net/tYCG5vcw2v3d4HCPptJhWj.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBS)</span></figcaption></figure><h2 id="60-the-nanny">60. The Nanny</h2><p><em>The Nanny</em> has long been synonymous with its star Fran Drescher, who played the titular Nanny Fine throughout the show’s six-season run on CBS. Despite being a quintessential ‘90s sitcom, the show’s comedy still feels super fresh and contemporary, even if the pop culture references are dated. Descher is truly unbelievable as Fran, and <em>The Nanny</em> has one of the best TV theme songs of all time. And it’s a show that younger generations absolutely NEED to binge-watch, amidst the ongoing hope for fans to see more. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="a4AgkmxdoeeKnTXVKhiqVT" name="" alt="Archer and Lana on motorcycle in Archer" src="https://cdn.mos.cms.futurecdn.net/a4AgkmxdoeeKnTXVKhiqVT.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: FX)</span></figcaption></figure><h2 id="59-archer">59. Archer</h2><p>If <em>Archer</em> were merely an expertly crafted James Bond parody, we’d still love it. However, this long-running FX staple’s greatness comes from the lore-heavy, spy-fi universe that creator Adam Reed’s built atop the back of loving send-ups to the espionage subgenre. H. Jon Benjamin anchored an all-timer voice cast that delivered dialogue and performances as sharp as Lana’s switchblade. The show veered from staleness by aping different genres for <em>Danger Island</em> and other “Coma Seasons,” further widening the comedic field of play, and I can’t imagine anyone wouldn’t finger <em>Archer</em> as the wildest workplace sitcom to date. Phrasing, BOOM!</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="Dj8pHPna9aACsLz3CSz7Sd" name="" alt="Henry Winkler as Fonzie in Happy Days" src="https://cdn.mos.cms.futurecdn.net/Dj8pHPna9aACsLz3CSz7Sd.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CS)</span></figcaption></figure><h2 id="58-happy-days">58. Happy Days</h2><p>When one thinks of <em>Happy Days</em>, the first image that likely comes to mind is Henry Winkler’s Arthur "Fonzie" Fonzarelli giving a cool-as-hell thumb’s up. Though he was initially just a minor player, the leather-donning jukebox-smacking ladie’s man quickly became the show’s most popular character. But its picturesque version of the 1950s and 1960s is just as iconic, as is the entire Cunnhingham family (except maybe for the <a href="https://www.cinemablend.com/television/what-is-the-chuck-cunningham-syndrome-and-big-tv-character-examples"><u>disappearing brother Chuck</u></a>) and further ensemble, which spawned a whopping seven spinoffs. And if you don’t agree with all that, well, sit on it!</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="cs2xzAHAcgyrBPYHNweNwU" name="" alt="Martin Lawrence and Carl Anthony Payne III on Martin" src="https://cdn.mos.cms.futurecdn.net/cs2xzAHAcgyrBPYHNweNwU.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Warner Bros.)</span></figcaption></figure><h2 id="57-martin">57. Martin</h2><p>A couple of years before he became an action movie king in <em>Bad Boys</em>, Martin Lawrence created and starred in his own sitcom, which gave fans five seasons of <a href="https://www.cinemablend.com/television/the-best-martin-episodes-ranked"><u>over-the-top episodes</u></a>. Lawrence’s Martin Payne is a loud, rambunctious, and highly opinionated Detroit disc jockey who constantly finds himself in all kinds of trouble both at work and at home with Tisha Campbell’s Gina. (A dynamic that shifted in the final season for BTS reasons.) Martin himself was fun, but his various other personas —Sheneneh Jenkins, Rosco, and Dragonfly Jones — gave the sitcom a fun and unique spin, foreshadowing Lawrence’s later career.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="WSUBiQRkCqV9f7uRUDr2SG" name="" alt="The Living Single cast" src="https://cdn.mos.cms.futurecdn.net/WSUBiQRkCqV9f7uRUDr2SG.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Fox)</span></figcaption></figure><h2 id="56-living-single">56. Living Single</h2><p><em>Living Single</em> is one of those sitcoms that thankfully managed to age well , premiering back in 1993 and following a group of friends residing together in a Brooklyn brownstone. With a killer cast including Queen Latifah (who also performed the outstanding theme song), Kim Coles, Kim Fields and Erika Alexander, <em>Living Single</em>’s formula succeeded ahead of <em>Friends</em> reaching more sensational heights, and the topic of influences there has made for many discussions. Regardless, the sitcom is a Black TV treasure, and boasts a trove of terrific musicians, athletes and comedians as guest stars, from Flip Wilson to Chaka Khan.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="M2ec6YVUG6PSFt97uZEzG3" name="" alt="Debra Messing and Eric McCormack on Will & Grace" src="https://cdn.mos.cms.futurecdn.net/M2ec6YVUG6PSFt97uZEzG3.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="55-will-and-grace">55. Will and Grace</h2><p><em>Will & Grace</em> might as well have also had Jack and Karen in the title as well, such was the strength of this foursome as they unsuccessfully dated and schmoozed their way to making LGBTQ+ history. The NBC Must See TV classic was an Emmy darling during its initial eight-season run, and its ongoing popularity beyond the “final” season inspired NBC to revive it for another two seasons. Which thankfully meant more from the bevy of guests and recurring stars that popped up over the years, from Matt Damon to Matt Bomer to Madonna.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="KGJdpMmfaWC6xFa3FELkNN" name="" alt="candice bergen on murphy brown" src="https://cdn.mos.cms.futurecdn.net/KGJdpMmfaWC6xFa3FELkNN.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBS)</span></figcaption></figure><h2 id="54-murphy-brown">54. Murphy Brown</h2><p>Sure, <em>Murphy Brown</em> fulfilled the sitcom basics of starring a single, middle-aged working woman (whose eventual single-mom status shook up the status quo), being funny, and serving up great characters — Jim Dial, slugger — to support the Aretha Franklin-loving titular lead. Arguably most important, though, its its rare delivery of a flawed female main character (recovering alcoholic) who’s frequently irascible, dedicated to her job as a journalist, and unafraid to speak up in a male-heavy industry, giving audiences every reason to root for through every uproarious rant and unnecessary assistant change. There’s a reason Candice Bergen earned five Emmys from seven nominations for her work across ten seasons. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="AfHX6aKWUfGsBqY6vK76nX" name="" alt="Bob Hartley in kitchen in The Bob Newhart Show" src="https://cdn.mos.cms.futurecdn.net/AfHX6aKWUfGsBqY6vK76nX.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: YouTube)</span></figcaption></figure><h2 id="53-the-bob-newhart-show">53. The Bob Newhart Show</h2><p>Nobody can do deadpan humor quite like the eponymous star of <em>The Bob Newhart Show</em>. The beauty of this 1970s sitcom was that it allowed Bob Newhart to play off of those stand-up comedy strengths, acting as the straight man to his psychologist Bob Hartley’s many unique patients. Co-starring Suzanne Pleshette as Bob’s beloved wife Emily — the two made sitcom history together on his next sitcom as well — and Peter Bonerz and Bill Daily as his pals, <em>The Bob Newhart Show</em> remains exemplary for its character-driven laughs.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="NAVHFbgYnQmxg6GFJJ5mtg" name="" alt="Redd Foxx and Demond Wilson on Sanford and Son" src="https://cdn.mos.cms.futurecdn.net/NAVHFbgYnQmxg6GFJJ5mtg.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="52-sanford-and-son">52. Sanford And Son</h2><p>The laughs that <em>Sanford and Son</em> delivers from episode to episode are fairly unique compared to other sitcoms. Redd Foxx and Demond Wilson are perfectly cast as Fred and Lamont Sanford, respectively, playing off of each other in ways reminiscent of comedy duos in vaudeville and radio shows. The writers also deserve a lot of credit for effectively employing racial humor, considered edgy at that time, as well as for bringing in hilarious characters like “Aunt” Esther Anderson and Grady Wilson. But Foxx – who just oozes superior comedic timing – steals so many scenes with his energetic performances. “This is the big one!”</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="TFwM3JcJA9pgDFVkTy2dPP" name="" alt="some of the cloud 9 employees on superstore" src="https://cdn.mos.cms.futurecdn.net/TFwM3JcJA9pgDFVkTy2dPP.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="51-superstore">51. Superstore</h2><p>All things consumerism considered, it’s almost surprising so few workplace comedies are anything like <em>Superstore</em>. For six seasons, viewers watched Amy (Oscar nominee America Ferrera), Jonah (Ben Feldman) and their wacky big box store co-workers readily getting into myriad insane scrapes and intriguingly complicated relationships, while trying to maintain order (or causing disorder) within the retail sphere. <em>Superstore</em> gives fans peak workplace sitcom, with innumerable sight gags for those watching closely, as well as a low-key, slow-burn mystery involving feet showing up all over the store.  It’s a hilarious win-win that theoretically helps everyone see their jobs aren’t as bad as they could be.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="Upmdg9PfnSz3ng8fEioLCd" name="" alt="Will Smith on the Fresh Prince of Bel-Air." src="https://cdn.mos.cms.futurecdn.net/Upmdg9PfnSz3ng8fEioLCd.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="50-the-fresh-prince-of-bel-air">50. The Fresh Prince Of Bel-Air</h2><p>Before the <em>Men in Black</em> and <em>Bad Boys</em> franchises and that Academy Award-winning role in <em>King Richard</em>, Will Smith veered away from his successful rap career to introduce viewers to…Will Smith…for <em>The Fresh Prince of Bel-Air</em>. Just saying its name instantly brings its classic theme song to mind. </p><p>Following a kid from West Philly sent off to live with his affluent uncle’s family in Bel-Air, this sitcom oozed ‘90s sitcom charm and hilarity, helping Will Smith expand his comedic talents opposite the great James Avery, Janet Hubert (for a spell) and more. From the Carlton dance to that classic “very special episode” where Will gets shot, <em>Fresh Prince</em> features plenty of justification for its continued success in syndication and streaming.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="oFfMtW65kt7p6rCZCdZRrX" name="" alt="Alex and Mallory Keaton in Family Ties" src="https://cdn.mos.cms.futurecdn.net/oFfMtW65kt7p6rCZCdZRrX.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: YouTube)</span></figcaption></figure><h2 id="49-family-ties">49. Family Ties</h2><p>Eventually, <em>Family Ties</em> became known as “The Michael J. Fox Show,” and it was hard to avoid. Fox was a charismatic ball of energy who became a bona fide superstar during the run of the show, and even eclipsed famous guest stars such as Tom Hanks when they appeared. </p><p>But before Fox reached all-star status, <em>Family Ties</em> won over audiences as a warm, endearing, and relatable sitcom about liberal parents trying their best to raise their three kids – one of whom happened to be a briefcase-toting, card-carrying Republican. We all saw ourselves in at least one member of the Keaton family, and tuned in weekly to appreciate the ties that bound them all together.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="mF898g9nBCM92hAZRkbUkh" name="" alt="Rowan Atkinson as Mr. Bean" src="https://cdn.mos.cms.futurecdn.net/mF898g9nBCM92hAZRkbUkh.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: BBC)</span></figcaption></figure><h2 id="48-mr-bean">48. Mr. Bean</h2><p>Rowan Atkinson would have been amazing during the silent film era, but is thankfully a more modern talent, since we otherwise might never have known  the childlike, frustration-spiked foibles of Mr. Bean. Co-created by the comedian’s <em>Black Adder</em> partners in hilarity, Ben Elton and Richard Curtis, <em>Mr. Bean</em> is an idiosyncratic sitcom in that its five-year stretch comprised 15 sporadically aired one-off episodes, as opposed to seasons, which inspired a pair of feature films, an animated series, and more pop culture greatness. </p><p>Atkinson brings his physical comedy mastery to a plethora of disaster-laden circumstances, from nonchalantly changing into a swimsuit to getting ready for the dentist while driving to being locked out of a hotel room and dozens of other awkward moments. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="xJVgpmuZ8BndG2zfSMWeu3" name="" alt="Kaitlin Olson having a disagreement at the table in The Mick." src="https://cdn.mos.cms.futurecdn.net/xJVgpmuZ8BndG2zfSMWeu3.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: 20th Century Fox Television)</span></figcaption></figure><h2 id="47-the-mick">47. The Mick</h2><p>Only two seasons of <em>The Mick</em> aired between January 2017 and April 2018, telling the story of a foul-mouthed dirtbag forced to be the guardian of her affluent niece and nephews, and all 37 episodes are send-you-doubled-over-off-your-couch hilarious. Which means a lot of people were sleeping on this brilliance when it aired, and we’re still sore about it.</p><p>Led by Kaitlin Olsen, the entire cast is spectacular (with a special hat tip to the brilliant Scott MacArthur as the oft-injured ne'er-do-well Jimmy), but what truly makes this show exceptional is its beyond-dark sensibilities and unwillingness to accept the idea of a “line” that can’t be crossed. The final scene of the series finale is actually a perfect ending in that sense, and we’re sure that more seasons would have pushed it higher up the rankings.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="So6Dj4wUGnq5GDyHLnnDNG" name="" alt="Sherman Hemsley on The Jeffersons" src="https://cdn.mos.cms.futurecdn.net/So6Dj4wUGnq5GDyHLnnDNG.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBS)</span></figcaption></figure><h2 id="46-the-jeffersons">46. The Jeffersons</h2><p>Norman Lear & Co.nailed it when they moved George, Louise and Lionel Jefferson from <em>All in the Family</em> to their own show. <em>The Jeffersons</em> is 30-minute comedy at its finest, offering an excellent premise, and an array of interesting stories built on it. Sherman Hemsley and Isabel Sanford are electric as George and Lousie, effortlessly conveying their on-screen marriage with warmth, humor and occasional contention, all while surrounded by a strong supporting cast.</p><p>There’s also the series’ impact on Black culture and the TV landscape as a whole. It’s one of the earliest shows to have depicted an upper class African American family – and the complexities of such a dynamic. We should all be grateful that these characters moved on up.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="ijdEvi3ezV7aQrqn9JFofG" name="" alt="Liz (Tina Fey) and Jack (Alec Baldwin) take the stage at Liz's high school reunion" src="https://cdn.mos.cms.futurecdn.net/ijdEvi3ezV7aQrqn9JFofG.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="45-30-rock">45. 30 Rock</h2><p>If there were any doubts that Tina Fey could transport her magic touch from <em>SNL</em> to a scripted sitcom, <em>30 Rock</em> proved them pointless. The show-within-a-show’s very first season won the Emmy for Outstanding Comedy Series, and scored nominations for Tina Fey and Alec Baldwin. (Both went on to win elsewhere in the NBC comedy’s seven-season run.)</p><p>The show is infinitely quotable, thanks in large part to Tracy Morgan and Jane Krakowski, and recruited standout part-time stars ranging from Matt Damon to David Schwrimmer to – of course – Steve “How do you do, fellow kids?” Buscemi. Plus, it imparted the following important lesson from Tracy Jordan: “Live every week like it’s Shark Week.” No <em>SNL</em> knowledge is needed to appreciate the sketch-skewing humor, but it’ll help.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="7YDSvbhnYEe4croCqUgaDg" name="" alt="Donald Faison and Zach Braff on Scrubs" src="https://cdn.mos.cms.futurecdn.net/7YDSvbhnYEe4croCqUgaDg.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="44-scrubs">44. Scrubs</h2><p>Hospital dramas have become as commonplace as any TV offering, so having <em>Scrubs</em> around to follow its doctors, nurses and Sacred Heart staff through a comedic lens continues to be a welcome respite. Not to say <em>Scrubs</em> wasn’t without its emotional and poignant moments, since one could argue it functions nearly as well as a dramatic series when in that mode. </p><p>But the humor is where <em>Scrubs</em>’ gets surgical with it. Whether we were joining J.D. in his wild daydreams, or the crazy events unfolding between characters while treating patients, this show excelled at delivering the laughs. If only we could witness John C. McGinley’s Dr. Cox ranting at residents while a nameless Janitor pranks people within a real-life hospital. Additionally, J.D. and Turk are one of TV’s all-time best-buddy pairings.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="DuufhAui5XdTLymtv4jtek" name="" alt="bob, louise, tina, gene and linda belcher on the couch in bob's burgers" src="https://cdn.mos.cms.futurecdn.net/DuufhAui5XdTLymtv4jtek.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Fox)</span></figcaption></figure><h2 id="43-bob-39-s-burgers">43. Bob's Burgers</h2><p>In all of sitcom family-dom, few clans are as relatable in their middle-class weirdness as the Belcher family that serves up the titular meals and good-time goofiness on <em>Bob’s Burgers</em>. The beloved series from creator Loren Bouchard has followed sitcom standards to a T while building up its hilarity-filled universe of Italian restaurateur rivals, handyman besties, and plenty of schoolchildren I’d much rather watch on TV than deal with at home. But it’s the Belchers that keep us coming back.</p><p>From H. Jon Benjamin’s expertly exasperated attempts to get by to Louise’s rebellious sadism to Tina’s butt fascination, <em>Bob’s Burgers</em> is as timeless as the hamburger itself, and isn’t afraid to mix sweetness into the juvenile hijinks. A must-watch for pun enthusiasts.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="Ejq9xZMEZMMFNk2w8wYrpm" name="" alt="Bill Cosby in The Cosby Show" src="https://cdn.mos.cms.futurecdn.net/Ejq9xZMEZMMFNk2w8wYrpm.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: TV Land)</span></figcaption></figure><h2 id="42-the-cosby-show">42. The Cosby Show</h2><p>Decades after its debut on NBC, <em>The Cosby Show</em> remains a seminal piece of TV work. This sharp family comedy offers a warm look at a family (who just happened to be Black) and, while the Huxtables are quite pristine, they never feel unrelatable, except perhaps where sweaters are concerned. The impeccable ensemble boasts the likes of Phylicia Rashad, Malcolm-Jamal Warner and Keshia Knight Pulliam masterfully playing off the series’ titular star. Give the writing staff credit, too, for formulating some eternally classic episodes, like “Goodbye Mr. Fish” and “Happy Anniversary.” </p><p>Of course, the show’s legacy has been further evaluated due to Bill Cosby’s legal entanglements, and understandably so. That debate will surely continue, though what’s hard to deny is the sitcom’s game-changing position in the cultural lexicon.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="DimW922xzQu4Nph4Cb2Zsn" name="" alt="The Party Down cast" src="https://cdn.mos.cms.futurecdn.net/DimW922xzQu4Nph4Cb2Zsn.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Starz)</span></figcaption></figure><h2 id="41-party-down">41. Party Down</h2><p>“Are we having fun yet?” The oft-used sarcastic throwback to Henry’s (Adam Scott) singular professional achievement is actually a pretty fitting way to sum up the careers of the motley crew of caterers on <em>Party Down</em>. The aspiring actors and writers who comprise the eponymous catering company would certainly rather be pursuing their passions than serving drinks and apps to their rich customers, but with each episode plunking them into a different bougie event, it was delightful to see the ridiculous and usually cringey situations they would get themselves into. </p><p>On top of a fabulous ensemble cast featuring the likes of Ken Marino, Jane Lynch, Lizzy Caplan and Martin Starr, <em>Party Down</em> featured A+ cameos at each catering function. That Steve Guttenberg episode? Chef’s kiss, or at least a caterer’s kiss.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="RnbiUFr5XgKnSvhhMskx3C" name="" alt="The Boondocks Best of clips compilation." src="https://cdn.mos.cms.futurecdn.net/RnbiUFr5XgKnSvhhMskx3C.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Adult Swim)</span></figcaption></figure><h2 id="40-the-boondocks">40. The Boondocks</h2><p>We may never get another animated series about American society as unabashedly insightful as <em>The Boondocks</em>, which was created by Aaron McGruder and based on his comic strip of the same name. Each episode provides a thoughtful examination of the Black experience, principally seen through the eyes of young intellectual Huey Freeman and his gangster-wannabe brother Riley (both voiced by Oscar/Emmy Award-winner Regina King), under the spotty guidance of their John Witherspoon-voiced Granddad.</p><p>Not only does McGruder's bold writing provide clever observations about everything from rap music to movie theater decorum, but the anime style continues to remain eye-popping and brilliantly utilized. Especially with the killer kung-fu sequences, which demonstrate a deep love for both the animation medium and the martial arts action genre. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="NXabwKqJjjdauXA8Fmivei" name="" alt="Janine and Gregory sitting together and smiling in a school bus on Abbott Elementary" src="https://cdn.mos.cms.futurecdn.net/NXabwKqJjjdauXA8Fmivei.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><h2 id="39-abbott-elementary">39. Abbott Elementary</h2><p>Arguably one of the best sitcoms currently airing, <em>Abbott Elementary</em> took the world by storm when it premiered in 2021, introducing the world to Quinta Brunson’s brilliance as Janine Teagues. The <em>Black Lady Sketch Show</em> vet created, writes, produces and stars in the show centering on a Philadelphia school’s staff, and her care and love for it is infectious. </p><p>Between Gregory and Janine’s will-they-won’t-they relationship, hilarious talking heads and well-established characters with silly interests (like Ava being a doomsday prepper), this show has all the hallmarks of classic mockumentaries. However, its setting at an elementary school and the unique chemistry the incredible cast has developed make this ABC comedy one that will undoubtedly stand the test of time. (And it won’t need a stool like Janine, amirite, Ava?)</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="vf9PkXawxJnXbgJ5D47w8j" name="" alt="Chris O'Dowd as Roy in The IT Crowd" src="https://cdn.mos.cms.futurecdn.net/vf9PkXawxJnXbgJ5D47w8j.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Channel 4)</span></figcaption></figure><h2 id="38-the-it-crowd">38. The IT Crowd</h2><p>As if Graham Linehan’s entertainment legacy wasn’t already assured by <em>Father Ted</em>, the man went and crafted another all-time Britcom with <em>The IT Crowd</em>. (Okay, <em>Black Books</em>, too.) The basic premise follows the lives of corporate climber Jen (Katherine Parkinson) and IT department slackers Roy (Chris O’Dowd) and Moss (Richard Ayoade). A classic workplace sitcom trio if there ever was one. </p><p>In execution, the 25-episode run was far more fun and unpredictable than the set-up. Skewering corporate culture and malfeasance, as well as all things personal and pop, <em>The IT Crowd</em> feels like a cheeky mix between <em>Seinfeld</em> and <em>Spaced</em>. Not to mention this being a great place to get a Matt Berry fix.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="cWms2Fj4wx5Bsv3p97s68" name="" alt="The study group in Community" src="https://cdn.mos.cms.futurecdn.net/cWms2Fj4wx5Bsv3p97s68.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="37-community">37. Community</h2><p>It’s difficult to summarize what makes <em>Community</em> such an exceptional sitcom. Its meta awareness and deep love of pop culture is a key ingredient, executed principally through the genius character that is Danny Pudi’s Abed Nadir. But that’s an example of the phenomenal way the show balances the unique voices of its seven main characters – be it the confident idiocy of Donald Glover’s Troy Barnes, the extreme selfishness of Joel McHale’s Jeff Winger, or ridiculous uptightness of Alison Brie’s Annie Edison.</p><p>These characters planted in an environment of ever-growing weirdness that is Greendale Community College permits wild, creative, and clever single episode stories… but also not to be slept on are its effective emotional swings (Like I said, it’s really <em>Dean</em>-ficult to sum up!)</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="xDn34vV8khbLniWSNiGdxL" name="" alt="phil teaching haley how to work the remote on modern family." src="https://cdn.mos.cms.futurecdn.net/xDn34vV8khbLniWSNiGdxL.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><h2 id="36-modern-family">36. Modern Family</h2><p><em>Modern Family</em> was one of the first family sitcoms to eschew studio audience laughter for the single-camera format, and its massive success and influence was undeniable. Running for eleven seasons, the star-studded sitcom gave viewers a front seat to watching the blended Pritchett and Dunphy families grow up together. </p><p>But what makes <em>Modern Family</em> one of the best sitcoms ever is its relatability and ability to tap into all the emotions. There’s plenty to laugh at, thanks to hilarious deliveries from Ed O’Neill, Julie Bowen, Ty Burrell and others, and more episodes than can be poignant, whether it’s about love, sexuality, growing up, or plenty of other feelings to connect to. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="NgXdkBFFRYVH8UiVtrj75G" name="" alt="Jason and Justine Bateman on Arrested Development" src="https://cdn.mos.cms.futurecdn.net/NgXdkBFFRYVH8UiVtrj75G.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="35-arrested-development">35. Arrested Development</h2><p>At the far end of the “wholesome sitcom family” spectrum is the Bluth clan responsible for the majority of the conning and downward spiraling on <em>Arrested Development</em>. (Ron Howard’s Narrator: “They really were.”) With too many A+ cast members to namecheck in one breath, the fourth wall-breaking comedy is technically about the legal troubles surrounding the family company following a major scandal, but it’s <em>really</em> about the family’s myriad other problems.</p><p>Let’s see, we have twin-fidelity, oedipal complexes galore, PTSD from both Army (Mother!) and loss of limb, rampant alcoholism, potentially incestuous foreplay, hair metal magic, and never-nudism, though that’s a corner of a snowflake atop the tallest mountain of comedic quirks. Come for the brilliant performances, stay for the smartest callback jokes on TV.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="xMqMqQjPyneDbEk3rnvg9G" name="" alt="Johnny Fever and Herb in WKRP in Cincinnati" src="https://cdn.mos.cms.futurecdn.net/xMqMqQjPyneDbEk3rnvg9G.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: YouTube)</span></figcaption></figure><h2 id="34-wkrp-in-cincinnati">34. WKRP In Cincinnati</h2><p><em>WKRP in Cincinnati</em> is one of those shows that never seems to receive its flowers quite enough alongside others from the era. Airing for four seasons between 1978 and 1982, the comedy takes place at a struggling AM radio station in the heart of the Midwest, and boasts everything one would want in a sitcom: great jokes, iconic characters, and unforgettable TV moments.</p><p>Despite early schedule struggles, <em>WKRP</em> eventually found its footing on CBS, thanks to audiences loving the comedic stylings of Howard Hesseman’s Dr. Johnny Fever, Tim Reid’s Venus Flytrap, and Richard Sanders’ Les Nessman. It’s always been a hit with radio DJs, for good reason, and produced quite possibly the greatest Thanksgiving TV treat (that doesn’t have Charlie Brown in it) with “Turkeys Away.”</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="ArKYqcKEWkyKQHynDrbaoR" name="" alt="Jay Sherman chatting it up on The Critic" src="https://cdn.mos.cms.futurecdn.net/ArKYqcKEWkyKQHynDrbaoR.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC/Fox)</span></figcaption></figure><h2 id="33-the-critic">33. The Critic</h2><p>In the wake of <em>The Simpsons</em>’ success, creators Al Jean and Mike Reiss shaped a cult classic with <em>The Critic</em>, focused on bitter film critic Jay Sherman, voiced with gusto by Jon Lovitz. The animated sitcom took after its spiritual cousin, offering up both heartfelt and cuttingly satirical gags, and bouncing from ABC to Fox only sharpened the show’s edge.</p><p>Keenly lampooning the world of show business, <em>The Critic</em>’s writers crafted A+ parodies of classic films, fake cinematic atrocities so bad they’re funny, and welcomed cameos from actual critics. Anyone wanting to see Siskel & Ebert in a fist fight need look no further. Two words aptly sum up how we feel about this series not lasting nearly as long as <em>The Simpsons</em>: “It stinks.”</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="hTg2JmA5yZrgv7tJJbruP" name="" alt="Married With Children - Peggy Al Kelly Bundy" src="https://cdn.mos.cms.futurecdn.net/hTg2JmA5yZrgv7tJJbruP.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Sony Pictures Television)</span></figcaption></figure><h2 id="32-married-with-children">32. Married...with Children</h2><p>With Frank Sinatra’s “Love and Marriage” performance as its subversively optimistic theme song, <em>Married with Children</em> is the gleefully bawdy archetype for sitcoms about miserable people. Ed O’Neill’s misogyny-encrusted slopfest Al Bundy stiff-arms his way through life with affection-seeking wife Peg, blonde joke incarnate daughter Kelly, and lazy hornball son Bud. And Katey Sagal, Christina Applegate and David Faustino are the epitome of “the family you love to watch, but would hate to live with.”</p><p>As the live-action series that put Fox on the map, <em>Married with Children</em> has long been celebrated for its politically incorrect humor and cartoonishly offensive storylines, and it remains among the <a href="https://www.cinemablend.com/television/2458782/the-5-most-offensive-tv-shows-of-all-time-according-to-a-study"><u>most offensive TV shows of all time</u></a>. But it worked because the Bundy’s always came out worse than anyone else.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="s3rqfUTU4eNBUibr3F76bm" name="" alt="Mabel and Dipper in Gravity Falls." src="https://cdn.mos.cms.futurecdn.net/s3rqfUTU4eNBUibr3F76bm.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Disney Channel)</span></figcaption></figure><h2 id="31-gravity-falls">31. Gravity Falls</h2><p>Gravity Falls’ offbeat sitcom greatness truly deserves recognition for a show that may be written off for being a Disney Channel original. Creator and cast member Alex Hirsch crafted a well-animated, off-kilter show that wins over younger viewers with its thrills, humor and heart, while also capturing older viewers with overarching mysteries, surprisingly deep lore, and barrages of callbacks, clues and pause-required animation details. (Long live Bill Cypher!)</p><p>At the center of all the madness is the perfectly realized Pines family — Grunkle Stan, Dipper and Mabel — and their friends and co-workers like Wendy, Soos and others. With two seasons and 40 episodes under its belt, <em>Gravity Falls</em> is a tight show that builds to a very satisfying conclusion, even if fans railed against its cancellation at the time. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="oe7RdEHzfDbNufCHACX5Wg" name="" alt="Amy Poehler as Leslie Knope" src="https://cdn.mos.cms.futurecdn.net/oe7RdEHzfDbNufCHACX5Wg.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="30-parks-and-recreation">30. Parks And Recreation</h2><p>When <em>Parks and Recreation</em> premiered, <em>SNL</em> and <em>UCB</em> vet Amy Poehler was its biggest name, but the careers of co-stars such as Nick Offerman, Chris Pratt, Retta and Aubrey Plaza exploded in the years after. And it’s no surprise, since the NBC sitcom is where they were able to hone their characters distinct personalities for seven seasons.</p><p><em>Parks and Rec</em> follows the misfit-lite group running Pawnee, Indiana’s parks department Indiana, and had little trouble getting into the wildest hijinks in each 30-minute runtime. The episode “Flu Season”  delivers the goods in a nutshell, between Amy Poehler pretending she’s not sick, Chris Pratt’s physical comedy, and Nick Offerman perfectly portraying Ron Swanson’s disdain for government work. <em>Parks and Rec</em> is a quirky and lively show that deserves a spot in everyone’s lives.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="8PRQP3j3A2srgGg5QpStbh" name="" alt="The main cast members of Letterkenny." src="https://cdn.mos.cms.futurecdn.net/8PRQP3j3A2srgGg5QpStbh.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Crave)</span></figcaption></figure><h2 id="29-letterkenny">29. Letterkenny</h2><p>It's not often that a show can lean heavily on both the importance of morals and the notion of violence, but <em>Letterkenny</em> managed to strike an amazing balance between the two for twelve seasons. The Canadian sitcom is known for its amazingly paced banter and extensive <a href="https://www.cinemablend.com/television/2553891/key-letterkenny-words-and-phrases-explained">wordplay and unique phrasings</a>. As if the amazing comedic timing wasn't enough, one of the main themes continues to acknowledge the importance of standing up for what you believe in and striving to do good in the world. "If a friend asks for help, you help them." </p><p>Creator and star of the show, Jared Keeso, has also recently hit another comedic home run in the <a href="https://www.youtube.com/watch?v=Va1VDrGw0Z0"><em>Letterkenny</em> extended universe</a> with the spinoff <em>Shoresy</em>. <a href="https://www.youtube.com/watch?v=Va1VDrGw0Z0"><em></em></a></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="MEqya45DRK67d4JtTWR4Md" name="" alt="Mary Tyler Moore and Betty White on The Mary Tyler Moore Show" src="https://cdn.mos.cms.futurecdn.net/MEqya45DRK67d4JtTWR4Md.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBS)</span></figcaption></figure><h2 id="28-the-mary-tyler-moore-show">28. The Mary Tyler Moore Show</h2><p>Four years after winning TV audiences’ hearts for the last time on <em>The Dick Van Dyke Show</em>, Mary Tyler Moore struck further gold with her own titular sitcom, earning a spot high on the pyramid of inspirational female pop culture icons. For seven seasons, Moore’s Mary Richards worked diligently amidst other colorful characters in the MJM newsroom, such as Gavin McCleod’s snarky Murray, Ted Knight’s dimwitted Ted,  and Ed Anser’s ever-stoic (and spinoff-bound) Lou Grant. Not to mention Betty White’s ego-puff Sue Ann. </p><p>Outside the office, some of the Emmy-amassing show’s best scenes featured Mary mixing it up with her neighbor buddies Rhoda and Phyllis, portrayed with respective pizazz by Valerie Harper and Cloris Leachman. “Chuckles Bites the Dust” and “The Last Show” are as good as sitcom TV gets.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="j5Gub2id6rMrb62fkUMygh" name="" alt="The Friends cast" src="https://cdn.mos.cms.futurecdn.net/j5Gub2id6rMrb62fkUMygh.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="27-friends">27. Friends</h2><p>“Best sitcom” conversations can’t happen without mentioning <em>Friends</em> once or a dozen times. As the epitome of Must-See TV in the 1990s and early aughts, the sitcom skyrocketed its six stars — Jennifer Aniston, Courteney Cox. Lisa Kudrow, Matt LeBlanc, Matthew Perry and David Schwimmer — to fame. Decades later, the reruns are ever-present on TV and streaming, and the gang’s catchphrases continue to resonate as new generations make their way through Central Perk’s doors..</p><p>You don’t even have to have been a regular viewer to have heard Ross’ infamous “Pivot!” shout, to have a favorite Chandler quote, or to take a side on the Ross and Rachel  “we were on a break” debate. Such universal recognition is relatively rare for a show that’s been off the air for 20 years.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="xBaTTNvsRNziWopFpZv2R5" name="" alt="The main cast of The Office." src="https://cdn.mos.cms.futurecdn.net/xBaTTNvsRNziWopFpZv2R5.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: BBC Two)</span></figcaption></figure><h2 id="26-the-office-uk">26. The Office (UK)</h2><p>We never would’ve met Steve Carell’s Michael Scott if there hadn’t been David Brent. Ricky Gerais and Stephen Merchant brought <em>The Office</em> to UK small screens in 2001 and, through two brief seasons and a Christmas special, introduced audiences everywhere to a new level of cringe in the form of this hilarious mockumentary series (one which kept its documentation scenarios realistic).</p><p>This dry and occasionally super-awkward comedy follows one branch of a paper company and its workers — played by Gervais, Martin Freeman, Mackenzie Crook, Lucy Davis and several other talented actors — as they attempt to get through each and every workday, dignity optional. It’s the simplicity of the show and the way the characters played off one another that made <em>The Office</em> a true gem.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="uqazNJR2MuyNkNkeVt7apG" name="" alt="Roseanne cast" src="https://cdn.mos.cms.futurecdn.net/uqazNJR2MuyNkNkeVt7apG.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBS)</span></figcaption></figure><h2 id="25-roseanne">25. Roseanne</h2><p>Whether viewers are from the working class midwest or other parts of the country, <em>Roseanne</em> found a way to be relatable to so many. Through the sea of picture-perfect television families came the tidal wave that is the Conner family, who bickered, joked and suffered through enduring hard times. At the core of it all was a family raised by two parents, portrayed by Roseanne Barr and John Goodman, whose love remained strong throughout.</p><p>The Conners were never the idealized family everyone strives to be, but still feels like a mirror of what blue class households are really like. And despite the baffling retconned lottery season, and Barr’s off-screen controversy, <em>Roseanne</em>’s comfort-TV legacy remains as timeless as the family’s living room furniture.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="eWYZpjU9FaJMxvgGVXCNoX" name="" alt="rob and Laurie dancing in night club in The Dick Van Dyke Show" src="https://cdn.mos.cms.futurecdn.net/eWYZpjU9FaJMxvgGVXCNoX.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: YouTube)</span></figcaption></figure><h2 id="24-the-dick-van-dyke-show">24. The Dick Van Dyke Show</h2><p>There are great workplace comedies and there are great domestic family comedies, but <em>The Dick Van Dyke Show</em> somehow stands out among the best ever in both capacities. From the moment Van Dyke goes barreling over that ottoman, you know you’re in for something special, as the star’s gifts for physical and verbal comedy are nearly unparalleled. He’s often not even the one delivering the best jokes, because his reaction to his legendary co-stars is the true punchline. </p><p>Speaking of, the show was very much a group effort, despite its single-star title. Conceived and written by co-star Carl Reiner, and co-starring the incomparable Mary Tyler Moore, Rose Marie, and Maury Amsterdam, all the pieces come together perfectly to make one of the most consistently high-quality sitcoms of all time.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="kxozqU7bYmGKGeQ4wPezCB" name="" alt="What We Do in the Shadows Season 5 poster" src="https://cdn.mos.cms.futurecdn.net/kxozqU7bYmGKGeQ4wPezCB.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: FX)</span></figcaption></figure><h2 id="23-what-we-do-in-the-shadows">23. What We Do In The Shadows</h2><p><em>What We Do in the Shadows</em> is a bonkers TV show that shouldn’t work, just like the vampires yelling “Bat!” shouldn’t work as a catchphrase, but it all absolutely does. The mockumentary, spunoff from the co-creators’ film of the same name, follows a group of ridiculous, socially out-of-touch bloodsuckers — save for energy vamp Colin Robinson and human familiar Guillermo — trying to prove their worth in Staten Island.</p><p>Despite how silly and NSFW the show is, movie-level prosthetics and visual effects help to elevate and add shocks to the narrative. The cast is truly outstanding, as it goes for any Matt Berry-infused cast, and <em>WWDITS</em> has earned as much awards recognition as any TV horror comedy. With murder and duplicitousness afoot, the series still hits all the sitcom benchmarks, including a fun neighbor (the mind-sapped Sean), a great theme song, and a bunch of A+ celebrity cameos.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="s2B2hpAh3PAFcpT78ocX7e" name="" alt="Rainn Wilson, Steve Carell, and John Krasinski on The Office" src="https://cdn.mos.cms.futurecdn.net/s2B2hpAh3PAFcpT78ocX7e.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="22-the-office-u-s">22. The Office (U.S.)</h2><p>Following the success of Ricky Gervais and Stephen Merchant’s brilliant U.K. series of the same name, Greg Daniels’ adaptation of <em>The Office</em> took the mockumentary style of its predecessor – along with some of the more amusing traits and dynamics of its characters – and set out to tell new stories with office workers in Scranton, Pennsylvania. </p><p>Whether it’s the hilarious standout ensemble of characters (led for most seasons by Steve Carell’s cringe-perfecting boss Michael Scott), the way it embraces the mundanity of office life, or how it follows years of these workers’ lives over years while squeezing every drop of humor along the way, <em>The Office</em> continues to be funny, relatable and — for many of us — a comfortable place to return to in the years since its fantastic 9-season run ended. Not to mention the timeless romances of Pam and Jim, Dwight and Angela, Phyllis and Bob Vance, Vance Refrigeration.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="uSrjCY63CefWxudMqx9nCF" name="" alt="Cartman, Kenny, Stan and Kyle on South Park." src="https://cdn.mos.cms.futurecdn.net/uSrjCY63CefWxudMqx9nCF.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Comedy Central)</span></figcaption></figure><h2 id="21-south-park">21. South Park</h2><p>With more than 25 seasons and a growing number of one-off specials, <em>South Park</em> reigns supreme as a long-running pillar of TV satire. A look at the <a href="https://www.cinemablend.com/television/2474472/the-10-best-south-park-episodes-ranked"><u>20 best episodes</u></a> from the series is an easy way to effectively understand just how relevant this series has been on so many levels, evolving from a Kenny-killing, catchphrase machine to a show with a lot more to say than T-shirt fodder.</p><p>What other TV series, much less animated comedy, has taken on major religious institutions, accused killers, wild dieting trends, controversial music superstars and world politics throughout its run? If others exist, they probably didn’t do it as well as <em>South Park</em> does, and there’s still no end in sight to the Trey Parker and Matt Stone’s pop culture phenomenon, even if the duo have understandably been less prolific animators in later years.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="Zw6oAN84VtXDgbWeuqCPXU" name="" alt="Cast of Brooklyn Nine-Nine in The Last Day screenshot" src="https://cdn.mos.cms.futurecdn.net/Zw6oAN84VtXDgbWeuqCPXU.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="20-brooklyn-nine-nine">20. Brooklyn Nine-Nine</h2><p>From some of the <a href="https://www.cinemablend.com/television/2570596/brooklyn-nine-nines-best-cold-opens-from-the-series-so-far-ranked"><u>best TV cold opens</u></a> – <a href="https://www.cinemablend.com/television/the-story-behind-brooklyn-nine-nines-viral-cold-open-backstreet-boys"><u>“I Want It That Way” sung by suspects</u></a>, I mean, come on, it’s genius – to ongoing gags ike the annual heist, and “title of your sex tape” that make you laugh so hard your side hurts, <em>Brooklyn Nine-Nine</em> is a wild sitcom that is surprising in the best ways and absolutely irresistible as comfort comedy.</p><p>Led by Andy Samberg, Andre Braugher, Melissa Fumero, Stephanie Beatriz, Terry Crews and Joe Lo Truglio, this team of detectives quite literally never gets old, and <em>Brooklyn Nine-Nine</em> only got better in time as everyone grew comfortable in their roles and leaned into the silliness of their surroundings. Especially the all-time terrible cop duo of Hitchcock and Scully.</p><p>All around, what Dan Goor and Michael Schur created was so special, and as Jake Peralta would say “cool, cool, cool.” </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="neFVr27ND9jpYWSqiYvEBG" name="" alt="Dick and Joanna in Newhart" src="https://cdn.mos.cms.futurecdn.net/neFVr27ND9jpYWSqiYvEBG.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: YouTube)</span></figcaption></figure><h2 id="19-newhart">19. Newhart</h2><p>Bob Newhart struck TV gold a second time (not counting his stand-up appearances) with the endlessly cozy treasure <em>Newhart</em>, which centered on the comings and goings within the Stratford Inn in small-town Vermont. You know, the kind of small town where a man named Larry can have one brother named Darryl, and then also another brother named Darryl. It’s there where the star comedian and Mary Frann’s Dick and Joanna Loudon take over after a move from New York City, but their big-city know-how can’t quite compete with the quirkiness of their fellow residents.</p><p>Nothing ever gets old when it comes to watching the core cast — including Tom Poston, Julia Duffy and Peter Scolar — and the revolving door of recurring actors and guest stars bounce their energies off of Bob Newhart’s. And we’d be remiss not to give <em>Newhart</em> its flowers for shattering TV reality with its truly iconic finale twist.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="teVwypzMqknhwQfJNnCZAg" name="" alt="Carroll O'Connor and Jean Stapleton on All in the Family" src="https://cdn.mos.cms.futurecdn.net/teVwypzMqknhwQfJNnCZAg.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBS)</span></figcaption></figure><h2 id="18-all-in-the-family">18. All in the Family</h2><p><em>All in the Family</em> is arguably one of the most important TV series ever made, sitcom or otherwise, and shows don’t get the chance to change television if you’re not also good enough to stay on it in the first place. Not only was <em>All in the Family</em> successful enough to span eight seasons, but it also spawned five spinoffs. Despite the fact that the show’s primary character Archie Bunker was specifically designed to be the most bigoted person you know, it somehow all works so incredibly well. You love him even while you hate him, which is a testament to the abilities of creator Norman Lear and star Carroll O’Connor.</p><p>Dealing with, and poking fun at, topics that had been seen as taboo to even address previously, <em>All in the Family</em> courted its share of controversy and certainly ruffled some feathers. But that’s just further proof that it left an indelible and influential mark upon audiences everywhere.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1278px;"><p class="vanilla-image-block" style="padding-top:56.34%;"><img id="MofgC3DuPB8UxvJEEW4A46" name="" alt="Kelsey Grammer as Frasier Crane" src="https://cdn.mos.cms.futurecdn.net/MofgC3DuPB8UxvJEEW4A46.jpg" mos="" align="middle" fullscreen="" width="1278" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Paramount)</span></figcaption></figure><h2 id="17-frasier">17. Frasier</h2><p>For a TV spinoff to be anywhere near as popular as its parent show is a huge accomplishment, and NBC’s <em>Frasier</em> pulled off just such a transition following <em>Cheers</em>’ conclusion. To be sure, it was plainly great to see Kelsey Grammer’s Frasier Crane taking center stage after all those stool-sat years as an ensemble character. However, it’s unlikely the sitcom would have been nearly as successful without the supporting cast of David Hyde Pierce’s Niles, Jane Leeves’ Daphne, Peri Gilpin’s Roz and John Mahoney’s Martin. </p><p>These five characters’ unique personalities and the dynamics they share with one another make them one of the best sitcom casts of all time, and we’ll throw Eddie a bone there as well. Let’s not gloss over the intelligent writing Frasier consistently delivered, which was part of the show’s 37 Emmy wins over its eleven years on the air. Its continued popularity even sparked the Parmaount+ revival of the same name.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="DDnSnPJWWdmWMKNrqeVmE7" name="" alt="Latka, Alex, Jim and Tony in Taxi" src="https://cdn.mos.cms.futurecdn.net/DDnSnPJWWdmWMKNrqeVmE7.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: YouTube)</span></figcaption></figure><h2 id="16-taxi">16. Taxi</h2><p>Speaking to <em>Taxi</em>’s greatness takes little beyond listing the murderer’s row of talent yukking it up for five seasons at the Sunshine Cab Company: Judd Hirsch, Danny DeVito, Marilu Henner, Andy Kaufman, Tony Danza, Jeff Conaway, Christopher Lloyd, and Carol Kane. Theoretically, these actors could have struck gold with any TV narrative, but the New York setting provided the comedically ideal edge and neuroses that earned the show 18 Emmys and millions of fans. (Not that Kaufman’s Latka Gravas was a local.) Not to mention the quartet of sitcom royalty in creators James L. Brooks, Stan Daniels, David Davis, and Ed Weinberger.</p><p>Despite such over-the-top personalities, <em>Taxi</em> excels at grounded and heartfelt storytelling as much as broader humor, never shying away from the characters’ relatable struggles or the hot-button issues of the time. Extra points for its appearances from future <em>Cheers</em> stars Ted Danson, Rhea Perlman and George Wendt.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="C5uJhYsHbpg7GJ3qLq92SG" name="" alt="Betty White in The Golden Girls." src="https://cdn.mos.cms.futurecdn.net/C5uJhYsHbpg7GJ3qLq92SG.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="15-the-golden-girls">15. The Golden Girls</h2><p><em>The Golden Girls</em> is excellent enough to convince audiences that spending your twilight years in a shared living space with your mother and two roommates is a blueprint for endless laughs, when that might not match up with reality. It’s a credit to the stellar cast comprising Bea Arthur, Betty White, Rue McClanahan, and Estelle Getty. Queens, one and all. Amidst all the drama, the<a href="https://www.cinemablend.com/television/great-insults-from-the-golden-girls"> <u>endless insults thrown around</u></a>, and the cheesecake, the foursome’s friendship really shines through in this show. </p><p>It’s indeed that friendship that causes the gals to get into some absolutely wild adventures. Who can forget the time Rose nearly ended the Cold War with the Soviets with a letter? Not every narrative goes quite so big as that, even if Blanche plays up her romances as such, but it’s always a helluva fun ride. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="2TWEgk8jugHrnegUePmTKj" name="" alt="in Curb Your Enthusiasm series finale" src="https://cdn.mos.cms.futurecdn.net/2TWEgk8jugHrnegUePmTKj.jpeg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: HBO)</span></figcaption></figure><h2 id="14-curb-your-enthusiasm">14. Curb Your Enthusiasm</h2><p>After Seinfeld concluded its historic run in the late ‘90s, series co-creator Larry David could have ridden off into the sunset atop a horse made from residual checks. Instead, the stickler for human behavior not only created true sitcom brilliance, but also broke new ground for HBO and self-deprecating celeb cameos. </p><p><em>Curb Your Enthusiasm</em> — far more than a pretty, pretty, pretty good show — never failed to inspire laughs and shocks in equal order, following David’s over-the-top fictionalized version of himself (think George Costanza on shame-eliminating steroids), facing so many provocatively awkward situations with a vast array of friends, colleagues, contemporaries, and eventual enemies. (R.I.P. Richard Lewis and Bob Einstein.) The largely improvised show found new ways to be both relevant and funny across 24 years and 12 seasons, a task that’s easier said (and avoided) than done. And it also delivered an all-timer of a finale, <a href="https://www.cinemablend.com/interviews/curb-your-enthusiasm-co-creator-shares-origin-series-finale-seinfeld-homage-funny-story-behind-final-scene"><u>poking fun at </u><u><em>Seinfeld</em></u><u>’s polarizing conclusion</u></a>.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="dytuxPJuAUJNk6uNLK2yT8" name="" alt="Garry Shandling on The Larry Sanders Show" src="https://cdn.mos.cms.futurecdn.net/dytuxPJuAUJNk6uNLK2yT8.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: HBO)</span></figcaption></figure><h2 id="13-the-larry-sanders-show">13. The Larry Sanders Show</h2><p>As host of the fictional late night talk show <em>The Larry Sanders Show</em>, Garry Shandling implores his audience to stay tuned, ordering them, “No flipping!” It was an easy command to obey when it came to HBO’s <em>The Larry Sanders Show</em>, still one of the bravest, funniest, and most insightful programs that happily sinks its teeth into the Hollywood hand that feeds. </p><p>Larry is just an exaggerated caricature of Garry Shandling, who let all of his own neurosis and anxieties fly out of the mouth of his insecure comedic television personality who desperately wanted to be liked by his chosen industry. And the show got a lot of mileage out of real-life celebrities appearing and poking fun at their public personas. (David Duchovny for the win.) But it’s the supporting cast – led by the late Rip Torn and the wonderful Jeffrey Tambor – that elevates Larry Sanders to legendary status. There’ll never be another as biting and satirical as this.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="DfPAtj3G8rCKC34mhbcuSH" name="" alt="Simon Pegg and Jessica Hynes on Spaced" src="https://cdn.mos.cms.futurecdn.net/DfPAtj3G8rCKC34mhbcuSH.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: BBC)</span></figcaption></figure><h2 id="12-spaced">12. Spaced</h2><p>Simon Pegg and Nick Frost’s long history with director Edgar Wright includes the so-called Three Flavours Cornetto trilogy (<em>Shaun of the Dead</em>, <em>Hot Fuzz</em> and <em>The World's End</em>). Before that, though, they rocked the sitcom landscape with the UK gem <em>Spaced</em>.  A relatable premise is vital to a good sitcom, and it was so easy to fall in love with pro slacker Tim (Pegg) and the uber-dramatic Daisy (Jessica Stevenson) while shrewdly securing their affordable apartment under the watchful eye of Julia Deaken’s landlady Marsha.</p><p>In addition to watching Tim and Daisy maintain their ruse of being a “professional couple” while figuring out the whole adulting thing, <em>Spaced</em> — one of <a href="https://www.cinemablend.com/streaming-news/the-best-simon-pegg-movies-and-tv-shows-and-how-to-watch-them"><u>Simon Pegg’s best projects</u></a> — packed in endless horror movie references, video game easter eggs, and more pop culture love. (The pantomime gun fight is everything.) It also featured a supporting cast of hilariously exaggerated characters that will NOT have you wanting to “skip to the end.”</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="Vq7SFZv2Wf8LDyA7QviUeR" name="" alt="Tahani, Jason, Eleanor and Chidi on The Good Place" src="https://cdn.mos.cms.futurecdn.net/Vq7SFZv2Wf8LDyA7QviUeR.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="11-the-good-place">11. The Good Place</h2><p>Sitcoms are, by design, often stagnant, with the same characters facing similar situations week after week. If the jokes land, everything works, but if not, well… Then along came <em>The Good Place</em> to throw those preconceptions out the window. If creator Michael Schur had just repeated Season 1’s twisty premise for five seasons, it would have still been good, but <em>The Good Place</em> achieved true greatness with its storytelling.</p><p>Fronted by Kristen Bell and Ted Danson in top-tier fashion, <em>The Good Place</em> takes massive risks with its afterlife-set narrative, changing elements from one season to the next. The house of (God) cards would have tumbled down had it not all worked as infallibly as the big man himself, but it never even wavered. Indeed, <em>The Good Place</em> is simply forking unbelievable from beginning to end, buttressed by fully realized characters portrayed by co-leads William Jackson Harper, Jameela Jamil, Manny Jacinto, and D’Arcy Carden. Stream the show for everyone now, Janet. Janet..?</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="cwyfxFhY69e2GJvpiZUmsc" name="" alt="Basil Fawlty exasperated next to a corpse in a basket in Fawlty Towers" src="https://cdn.mos.cms.futurecdn.net/cwyfxFhY69e2GJvpiZUmsc.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Fawlty Vault YouTube)</span></figcaption></figure><h2 id="10-fawlty-towers">10. Fawlty Towers</h2><p>As part of Monty Python’s sextet of comedy masterminds, John Cleese had already conquered the world of sketch comedy and film, so the next obvious move was to craft a largely perfect sitcom with then-wife Connie Booth, and <em>Fawlty Towers</em> was just such perfection across twelve increasingly fraught. </p><p>Set within the non-existing titular hotel in Torquay, Cleese’s Basil Fawlty suffers the existence of everyone around him, especially Prunella Scales’ Sybil, his oft-demanding wife, and the language issues of Andrew Sachs’ Manuel, the establishment’s Spanish waiter. Booth’s chambermaid Polly gets slightly less irritation for being regularly competent. A hotel owner who hates his clientele is in the high-concept echelon, and the series offered up an eternally memorable selection of frequent and one-time guests, as well as builders, inspectors and others whose actions bring Basil’s blood pressure to a proper boil.</p><p>Similar to other classic ‘70s and ‘80s sitcoms, <em>Fawlty Towers</em> has been both celebrated and derided for its politically incorrect humor. It's perhaps exemplified best by the series’ marquee episode “The Germans,” and is something Cleese intends to replicate with the revival series he’s creating with daughter Camilla. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="rNcuYyF66fo5USPDpzcDsU" name="" alt="A screenshot of Ted Danson leaning against the bar in Cheers." src="https://cdn.mos.cms.futurecdn.net/rNcuYyF66fo5USPDpzcDsU.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="9-cheers">9. Cheers</h2><p>Locations can mean everything to a sitcom. Memorable shows are set in places to which we want to return, from Mel’s Diner to the Dunder Mifflin offices to, of course, the bar from <em>Cheers</em> – where everybody knows your name. Audiences became such regulars to the comfortable sitcom, we practically expected to hear our own names shouted out, a la Norm, when we turned the program on.</p><p>The familiarity and welcomeness of Cheers kept us tuning in, even as some of the cast rotated. We all invested heavily in the “will they or won’t they” relationship of barkeep Sam Malone (Ted Danson) and waitress Diane Chambers (Shelley Long), but stuck around when Diane was replaced by Rebecca (Kirstie Alley); and Southern simpleton Woody (Woody Harrelson) was embraced after first filling in for the departed Coach (Nicholas Colasanto). Not that anyone could ever replace Cliff Clavin.</p><p>Television hasn’t been the same since <em>Cheers</em> closed its doors, with <em>Frasier</em> going a completely different spinoff route, and I’m not sure another show can be set in a bar, and reach the high bar set by this program.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="uiMGWU5LrERZrqq6ZQqCig" name="" alt="The Simpson family being interviewed in the episode "My Life as A Vlog"" src="https://cdn.mos.cms.futurecdn.net/uiMGWU5LrERZrqq6ZQqCig.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Fox)</span></figcaption></figure><h2 id="8-the-simpsons">8. The Simpsons</h2><p>I think there’s an argument to be made that The Simpsons should have a place on any top 100 list when it comes to describing the best television, regardless of what additional parameters there may be. Part of the allure of this series, as it heads toward 800 episodes, is that there’s not really anything it hasn’t done at this point. There’s a Simpsons episode for whatever mood readers are feeling that day, though it may take a bit of research to figure out which one that is. </p><p>What I love most about The Simpsons is how the series has evolved with time and how the show has modernized the characters with the times while still retaining the core elements that audiences loved about them. Sure, seeing Homer Simpson send memes to Lisa on a smartphone can feel a bit jarring sometimes, but it’s also 100% on-brand for the patriarch and definitely less weird in the modern day to younger audiences compared to if he was still using a rotary phone. Plus, if you prefer the old stuff, it’s all available to stream on Disney+</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="DYtMVLQuzPpjZreMctx9od" name="" alt="Lucy Ricardo in Vitameatavegimin commercial episode of I Love Lucy" src="https://cdn.mos.cms.futurecdn.net/DYtMVLQuzPpjZreMctx9od.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: YouTube)</span></figcaption></figure><h2 id="7-i-love-lucy">7. I Love Lucy</h2><p>For the majority of TV’s existence as an entertainment platform, sitcoms have been synonymous with Lucille Ball, who achieved icon status several times over during her run as Lucy Ricardo in <em>I Love Lucy</em> (and other incarnations and later series). The series remains a blueprint reference for sitcom-crafting, and was revolutionary at the time for not only its star, but for her real-life husband Desi Arnaz portraying her faux hubby Ricky, and more.</p><p>While <em>I Love Lucy</em> could occasionally pull an emotional heartstring or two, its strength was comedy, and Ball maximized that concept throughout its run. Lucy and Ricky are as loud and wild a TV couple as can be, especially opposite their slightly more subdued neighbors Fred and Ethel Mertz. From Lucy’s efforts to get into Ricky’s shows to her attempts to hock Vitameatavegamin to her and Ethel’s conveyor belt struggles, the show regularly produced unforgettable sequences.</p><p><em>I Love Lucy</em> is also revolutionary for women in television, with Ball helping pave the way for so many other amazing female actresses to lead their own successful shows, even if struggles are still real on that front. No need for further ‘splanation: <em>I Love Lucy</em> is TV gold.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="LVikCXANAvzDh64E7H8zDj" name="" alt="dan levy david rose schitt's creek screenshot youtube" src="https://cdn.mos.cms.futurecdn.net/LVikCXANAvzDh64E7H8zDj.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBC)</span></figcaption></figure><h2 id="6-schitt-39-s-creek">6. Schitt's Creek</h2><p><em>Schitt’s Creek </em>didn’t truly hit the mainstream until its final season, but when people found it, its popularity exploded and its legacy was cemented. Created by father-son duo Dan and Eugene Levy, the comedy centers on a rich family who loses all their money, with the titular town as their silver lining. Annie Murphy and Catherine O’Hara co-star alongside the Levys in this most hilarious fish out of water story.</p><p>Seeing these four totally out of their element within the less-than-chic town is an easy way in for viewers. But the hooks that keep people watching are Catherine O’Hara’s ridiculous fake accent, Dan Levy’s sassy one-liners, Annie Murphy’s over-the-top everything as Alexis, Eugene Levy’s brilliant straight-man reactions, and the heartfelt growth this family goes through as they learn to love each other and the town they now call home. </p><p>Since the show became a sensation, lines like “Ew David!” have entered the everyday lexicon, and impersonations of Moira and Alexis can be seen frequently on social media. <em>Schitt’s Creek</em> shined bright when it was on — remember the network Pop? — and since then it’s cemented itself as a permanent part of the zeitgeist.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="HRiMD3u5mH2z3LiqjH2rnC" name="" alt="The main cast of It's Always Sunny in Philadelphia." src="https://cdn.mos.cms.futurecdn.net/HRiMD3u5mH2z3LiqjH2rnC.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: FXX)</span></figcaption></figure><h2 id="5-it-39-s-always-sunny-in-philadelphia">5. It's Always Sunny In Philadelphia</h2><p>Rarely does a piece of pop culture offer up a character who constantly proves themself to be unendingly vile, self-consumed, aloof, destructive and terrible for society. But a combination of those words describes literally every single character who speaks in <em>It’s Always Sunny in Philadelphia</em>. Of course, the biggest and most hilarious offenders are the central Paddy’s Pub gang made up of possible serial killer Dennis (Glenn Howerton), his slightly less evil Bird…e… sister Dee, the sexually fluid approval-seeking Mac (Rob McElhenny), glue-eating connoisseur and janitor Charlie (Charlie Day) and the shockingly demented and depraved Frank (Danny DeVito).</p><p>No stone goes unturned when it comes to shocking viewers with how low these characters will go to achieve even the most meaningless iota of recognition or selfish pleasure. There’s racially charged (and socially questionable) takes on <em>Lethal Weapon</em> and <em>The Wiz</em>, exploiting all manner of substance and behavior addictions, satirical jabs at gun control, welfare, sexual assault, and much more. Its unsanitary hilarity is cherished among fans who have watched it live on longer than any other TV comedy in history, with no end in sight. (Except for Danny DeVito’s bare one, that is.)</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="JN2dDSnTWjqRa3rtGiC6tY" name="" alt="hank, boomhauer, bill and dale work on a truck while drinking on king of the hill" src="https://cdn.mos.cms.futurecdn.net/JN2dDSnTWjqRa3rtGiC6tY.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Fox)</span></figcaption></figure><h2 id="4-king-of-the-hill">4. King Of The Hill</h2><p>Animation isn’t often a medium for classic sitcoms, but Mike Judge’s <em>King of the Hill</em> delivered on all fronts by settling audiences into the everyday life of the Hill family. Hank, Peggy, Bobby, and an assortment of other Arlen standouts kept viewers rolling and clamoring for more Southern-fried hilarity during its 13-season stretch. (And more is on the way thanks to <a href="https://www.cinemablend.com/streaming-news/why-king-of-the-hills-streaming-revival-has-me-so-danged-excited-i-tell-you-what"><u>Hulu’s revival</u></a>.)</p><p><em>King of the Hill</em> tackles issues while poking fun at them in ways that most viewers can probably relate to — from the stresses of the workplace to the terror of puberty to the awkwardness of family — adding a layer of realism to the two-dimensional characters’ world. To that end, Judge’s series is also atypical for adhering to realism throughout, as opposed to going off the cartoonish deep end for laughs (outside of dream sequences, that is).</p><p>Judge’s Hank and Kathy Najimy’s Peggy, along with Brittany Murphy’s Luanne and Pamela Adlon’s Bobby, provide a lot of the show’s heart and soul with their struggles and not-always-brilliant reactions to those struggles. But it always helps to have friends around like the hapless good’n Bill, the conspiracy-obsessed Dale and the mush-mouthed Boomhauer. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="QnkHaBYsLutkp6LKQVemAP" name="" alt="Jerry Seinfeld and Michael Richards on Seinfeld" src="https://cdn.mos.cms.futurecdn.net/QnkHaBYsLutkp6LKQVemAP.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Castle Rock)</span></figcaption></figure><h2 id="3-seinfeld">3. Seinfeld</h2><p>It’s joked that <em>Seinfeld</em> is “a show about nothing,” and that’s a fair surface-only assessment. The NBC hit provides no lasting messages or morals, and it focuses the majority of its creative energy on eccentric minutiae of everyday life – be it waiting forever for a table at a restaurant or getting in disputes with cashiers over proper change. Characters don’t grow or change — save for temporary shrinkage and mustache-growing — and there’s no reach for deep themes. They’re not even nice people.</p><p>And yet, it’s utterly brilliant, timeless, and endlessly rewatchable. </p><p>Jerry, George, Kramer and Elaine each have their own unique and hilarious personalities strengthened by the actors’ performances, which in turn drives hilarious stories that unlock the real magic of the show: the way everything intertwines. Kramer golfing on the beach is its own weird gag, but also perfectly sets up George being called into action to rescue a beached whale after previously lying about being a marine biologist. Just about every sitcom since the early 1990s has tried to capture some of the magic of the nine-season series, but there is only one <em>Seinfeld</em>. (A notion that Newman would applaud.)</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="e5m5taxEYCsR58eBDZx7Hf" name="" alt="Julia Louis-Dreyfus as Selina Meyer in VEEP" src="https://cdn.mos.cms.futurecdn.net/e5m5taxEYCsR58eBDZx7Hf.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: HBO)</span></figcaption></figure><h2 id="2-veep">2. Veep</h2><p><em>Veep</em> was the [<strong>censored</strong>] creation of Armando Iannucci, the mastermind known for <em>The Thick of It</em> and Alan Partridge’s various incarnations, and HBO’s political workplace comedy is dripping with just as much satire and [<strong>censored</strong>] as anything graced by his Midas touch before or after. It’s one of the fastest and foulest sitcoms to date, with a jokes-per-minute rate that rivals other rapid-paced greats like <em>The Simpsons</em> and <em>Arrested Development</em>, and a [<strong>censored</strong>]-per-minute rate that is second to none. </p><p>As it goes with the best of the best, <em>Veep</em> boasts and expansive ensemble of uppermost geniuses, as led by Emmy magnet Julie Louis-Dreyfus’ Vice President (and then some) Selina Meyer, whose struggles to remain a boss in Washington D.C. means absolute hell for the masses of aides, pundits, strategists, etc. in her orbit. That applies most to her body man and extra appendage Gary, played with aplomb by Tony Hale.</p><p>Every <em>Veep</em> co-star brings something perfect to the table, from Anna Chlumsky’s rage suppression as Amy to Matt Walsh’s common sense suppression as Mike; from Reid Scott’s smarm-oozing Dan to Timothy Simons’ arbitrary naysayer Jonah. And we’d just as easily watch spinoffs centered on Kevin Dunn’s Ben and Gary Cole’s Kent, as well as Sam Richardson’s go-getter Richard Splett. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="7k6vgPovjJ5iHRgyqfPNUA" name="" alt="Will Arnett and Weird Al Yankovic on BoJack Horseman" src="https://cdn.mos.cms.futurecdn.net/7k6vgPovjJ5iHRgyqfPNUA.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="1-bojack-horseman">1. BoJack Horseman</h2><p>One of the<a href="https://www.cinemablend.com/television/the-75-best-animated-TV-shows-of-all-time"> <u>best animated TV shows of all time</u></a>, Netflix’s <em>BoJack Horseman </em>took the adult-toon formula and evolved it into six seasons of one of TV history’s most unique offerings that — at least in CinemaBlend’s perspective — is the sitcom GOAT. Will Arnett is perfect voicing the tragic title character, a past-his-prime ‘90s sitcom star and substance abuser, and he’s bolstered by a who’s who of talented actors portrayed well-written characters, including<a href="https://www.cinemablend.com/television/tv-characters-with-arcs-so-good-they-became-fan-favorites"> <u>fan-favorites Diane Nguyen</u></a> (Alison Brie) and Mr. Peanutbutter (Paul F. Tompkins).</p><p>After establishing its sitcom formula in its earliest wordplay-embracing seasons, <em>Bojack Horseman</em> begins getting experimental with its format in phenomenal ways, such as with Season 3’s “Fish Out of Water,” a thought-provoking underwater story with no dialogue, or Season 5’s “Big Churro,” a full-length Bojack eulogy following a<a href="https://www.cinemablend.com/television/2464292/the-biggest-tv-deaths-of-2018"> <u>big character death</u></a>. </p><p>There are certainly laughs to be had, for sure — big, hearty, consistent, gut-shredding, animalistic laughs throughout all six seasons — but don’t be surprised if you end up shedding a tear or suffering an existential crisis or two along the way as well. The show-within-a-show <em>Horsin’ Around</em> probably wouldn’t have made it onto this list, but <em>BoJack Horseman</em> itself is a Triple Crown winner of the highest order.</p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ 11 Shows Like Curb Your Enthusiasm And How To Watch Them ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/shows-like-curb-your-enthusiasm</link>
                                                                            <description>
                            <![CDATA[ Loving Curb Your Enthusiasm means you might also like these other funny TV shows. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">c7A6izA3kRqxkmgsijBrFJ</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/fr5poFiuoQoDiBLYxzFSUT-1280-80.jpeg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Wed, 20 Mar 2024 13:04:34 +0000</pubDate>                                                                                                                                <updated>Wed, 22 Jan 2025 15:16:37 +0000</updated>
                                                                                                                                            <category><![CDATA[Television]]></category>
                                                                                                                    <dc:creator><![CDATA[ Jason Wiese ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/62SRu9Bi2SyJGrpzKXAfsK.jpg ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Jason Wiese writes feature stories for CinemaBlend. His occupation results from years dreaming of a filmmaking career, settling on a &quot;professional film fan&quot; career, studying journalism at Lindenwood University in St. Charles, MO (where he served as Culture Editor for its student-run print and online publications), and a brief stint of reviewing movies for fun. He would later continue that side-hustle of film criticism on TikTok (@wiesewisdom), where he posts videos on a semi-weekly basis.&lt;/p&gt;&lt;p&gt;&lt;br&gt;&lt;/p&gt;&lt;p&gt;Jason has been writing since he was able to pick up a washable marker, with which he wrote his debut illustrated children&#039;s story, later transitioning to a short-lived comic book series and (very) amateur filmmaking before finally settling on pursuing a career in writing about movies in lieu of making them. Look for his name in almost any article about Batman.&lt;/p&gt;&lt;p&gt;&lt;br&gt;&lt;/p&gt;&lt;p&gt;&lt;strong&gt;What He&#039;s Into&lt;/strong&gt;: Readers may notice a recurring theme of horror and superhero-related content (especially in regards to Batman) in much of Jason&#039;s work, but his favorite film of all time is more in line with traditional action/adventure stories: &lt;em&gt;Raiders of the Lost Ark&lt;/em&gt;. His favorite TV series is the gritty, grounded crime thriller &lt;em&gt;Breaking Bad&lt;/em&gt; and if you catching him reading anything, it is probably a comic book (and, more often than not, one featuring Batman). More important to him than entertainment, however, are his wife and two dogs.&lt;/p&gt;&lt;p&gt;&lt;br&gt;&lt;/p&gt;&lt;p&gt;&lt;strong&gt;What He&#039;s Excited About Right Now&lt;/strong&gt;: Jason typically tries to keep his excitement and expectations for any upcoming movies as low as possible, but he is certainly looking forward to returning to Matt Reeves&#039; vision of Gotham City in the upcoming follow-up to &lt;em&gt;The Batman&lt;/em&gt; and just about any horror movie set to haunt cinemas soon.&lt;/p&gt; ]]></dc:description>
                                                                                                                                <cf:isSponsored>false</cf:isSponsored>
                <cf:hasAffiliateLinks>false</cf:hasAffiliateLinks>
                <cf:isPaid>false</cf:isPaid>
                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/fr5poFiuoQoDiBLYxzFSUT-1280-80.jpeg">
                                                            <media:credit><![CDATA[HBO]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[Larry indecisive in Curb Your Enthusiasm]]></media:description>                                                            <media:text><![CDATA[Larry indecisive in Curb Your Enthusiasm]]></media:text>
                                <media:title type="plain"><![CDATA[Larry indecisive in Curb Your Enthusiasm]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/fr5poFiuoQoDiBLYxzFSUT-1280-80.jpeg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>The long-running HBO comedy, <em>Curb Your Enthusiasm</em> — created by and starring Larry David <a href="https://www.cinemablend.com/movies/great-performances-by-celebrities-playing-themselves-in-movies-and-tv-shows">as a fictionalized version of himself</a> — saw the comedian offend and alienate just about every person he interacted with while living in L.A., but he is not the only TV character with that sort of reputation. If the <a href="https://www.cinemablend.com/television/curb-your-enthusiasm-season-12-premiere-date-cast-and-other-things-we-know">end of <em>Curb Your Enthusiasm</em></a> still has you down, there are plenty of other TV shows that fans will love. See for yourself by taking a look at these other <a href="https://www.cinemablend.com/television/100-best-tv-sitcoms-of-all-time-ranked">great sitcoms</a> available to stream (or buy digitally or on physical media) that deliver comedy of the cringiest degree, and even some that also take massive jabs at show business.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="SSZntgNcmp35DxFuHkH9sn" name="seinfeld finale jail-id_94b35e8a-c7b5-4772-af12-e7cad59b11c8.jpeg" alt="Jerry, Elaine, George and Kramer in jail cell in Seinfeld series finale." src="https://cdn.mos.cms.futurecdn.net/SSZntgNcmp35DxFuHkH9sn.jpeg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="seinfeld-1989-1998">Seinfeld (1989-1998)</h2><p><strong>Starring:</strong> Jerry Seinfeld, Julia Louis-Dreyfus, Michael Richards, Jason Alexander</p><p><strong>What it's about:</strong> The misadventures of a comedian, his ex-girlfriend, his neighbor, and his childhood buddy.</p><p><strong>Why it is a great show for Curb Your Enthusiasm fans:</strong> We previously included <em>Curb</em> on a list of <a href="https://www.cinemablend.com/streaming-news/seinfeld-what-to-watch-if-you-like-the-iconic-comedy">shows like <em>Seinfeld</em></a> — not just because it also stars a comedian as a fictionalized version of himself, but also because David (along with Seinfeld) created and <a href="https://www.cinemablend.com/television/all-the-characters-larry-david-played-on-seinfeld">made numerous appearances</a> on the groundbreaking, Emmy-winning <a href="https://www.cinemablend.com/streaming-news/popular-90s-tv-shows-to-watch-streaming">classic ‘90s TV show</a> that reflects many of the same cynical philosophies and brand of humor.</p><p><strong>How to watch Seinfeld</strong></p><ul><li><a href="https://www.netflix.com/title/70153373"><strong>Stream Seinfeld on Netflix</strong></a></li><li><strong></strong><a href="https://www.amazon.com/Seinfeld-Seasons-1-2/dp/B0777TWP22"><strong>Buy Seinfeld on Amazon</strong></a></li><li><strong></strong><a href="https://www.amazon.com/Seinfeld-Complete-Jerry/dp/B00EIJTLK4"><strong>Buy Seinfeld on DVD on Amazon</strong></a></li></ul><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1282px;"><p class="vanilla-image-block" style="padding-top:56.16%;"><img id="gFaYgYusxe4YJLWL9CTxNg" name="league1-09 (1).jpg" alt="Some of the main cast members of The League." src="https://cdn.mos.cms.futurecdn.net/gFaYgYusxe4YJLWL9CTxNg.jpg" mos="" align="middle" fullscreen="" width="1282" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: FX)</span></figcaption></figure><h2 id="the-league-2009-2015">The League (2009-2015)</h2><p><strong>Starring:</strong> Mark Duplass, Nick Kroll, Paul Scheer</p><p><strong>What it's about:</strong> A group of middle-aged friends allows their obsession with putting together the perfect fantasy football line-up to bleed over into their personal lives in hazardous ways.</p><p><strong>Why it is a great show for Curb Your Enthusiasm fans:</strong> Fun fact about <em>Curb</em>: all the <a href="https://www.cinemablend.com/television/2566097/whose-line-is-it-anyway-and-other-improv-comedy-shows-to-watch-on-streaming">dialogue on the show is improvised</a>, just like one of the <a href="https://www.cinemablend.com/television/2495018/the-funniest-shows-on-hulu-right-now">funniest TV shows on Hulu</a>, <em>The League</em> — creators Jeff and Jackie Schaffer’s FX hit that also boasts a cynical brand of humor, but takes aim at the connection between sports and dysfunctional friendship.</p><p><strong>How to watch The League</strong></p><ul><li><a href="https://www.hulu.com/series/6723b153-45c2-43a4-947f-7cc64ef7f2a3"><strong>Stream The League on Hulu</strong></a></li><li><strong></strong><a href="https://www.amazon.com/The-Draft/dp/B00F34YNWE"><strong>Buy The League on Amazon</strong></a></li><li><strong></strong><a href="https://www.amazon.com/League-Complete-Value-Set/dp/B07MD8PFTF"><strong>Buy The League on DVD on Amazon</strong></a></li></ul><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="e7sEFuZv8Metc6n8TvnY5A" name="cedricyarbrough.jpg" alt="Cedric Yarbrough in Reno 911: The Hunt For Q Anon" src="https://cdn.mos.cms.futurecdn.net/e7sEFuZv8Metc6n8TvnY5A.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Paramount+)</span></figcaption></figure><h2 id="reno-911-2003-2022">Reno 911! (2003-2022)</h2><p><strong>Starring:</strong> Thomas Lennon, Kerry Kenney</p><p><strong>What it's about:</strong> A documentary crew observes the often uproarious antics of a Nevada sheriff’s department.</p><p><strong>Why it is a great show for Curb Your Enthusiasm fans:</strong> Another one of the most acclaimed predominantly improvised sitcoms in recent memory is <em>Reno 911!</em>, which actually reflects <em>Curb</em>’s legacy as a movie that spawned a series in reverse, as the Comedy Central mockumentary later inspired two movies, <em>Reno 911!: Miami</em> and <em>Reno 911! The Hunt for QAnon</em>.</p><p><strong>How to watch Reno 911!</strong></p><ul><li><a href="https://www.paramountplus.com/shows/reno-911/"><strong>Stream Reno 911! on Paramount+</strong></a></li><li><strong></strong><a href="https://www.amazon.com/Reno-911-Season-1/dp/B000JQT7I6"><strong>Buy Reno 911! on Amazon</strong></a></li><li><strong></strong><a href="https://www.amazon.com/Reno-911-Complete-Cedric-Yarbrough/dp/B00MWP738I"><strong>Buy Reno 911! on DVD on Amazon</strong></a></li></ul><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="gFm7AM9gutBe7MqxRgMTMo" name="i think you should leave.jpg" alt="Tim Robinson holding his head in I think You Should Leave" src="https://cdn.mos.cms.futurecdn.net/gFm7AM9gutBe7MqxRgMTMo.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="i-think-you-should-leave-with-tim-robinson-2019-present">I Think You Should Leave With Tim Robinson (2019-Present)</h2><p><strong>Starring:</strong> Tim Robinson, Sam Richardson</p><p><strong>What it's about:</strong> A series of comical vignettes that comment on life’s awkward moments to an exponentially maddening and strange degree.</p><p><strong>Why it is a great show for Curb Your Enthusiasm fans:</strong> Larry David might be a perfect fit for one of the <a href="https://www.cinemablend.com/television/best-sketch-comedy-tv-shows">best sketch comedy shows</a> in recent memory, <em>I Think You Should Leave</em>,<strong> </strong>which imagines various scenarios similar to the cringe-inducing moments he often gets himself in on <em>Curb</em>.</p><p><strong>How to watch I Think You Should Leave</strong></p><ul><li><a href="https://www.netflix.com/title/80986854"><strong>Stream I Think You Should Leave With Tim Robinson on Netflix</strong></a></li></ul><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="QvCBvAx9477GLGiUEr8QdD" name="bupkis pete.jpg" alt="Pete Davidson on Bupkis" src="https://cdn.mos.cms.futurecdn.net/QvCBvAx9477GLGiUEr8QdD.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Peacock)</span></figcaption></figure><h2 id="bupkis-2023-present">Bupkis (2023-Present)</h2><p><strong>Starring:</strong> Pete Davidson, Edie Falco, Joe Pesci</p><p><strong>What it's about:</strong> A heightened inside look at the life of Pete Davidson.</p><p><strong>Why it is a great show for Curb Your Enthusiasm fans:</strong> Speaking of sketch comedy, Larry David once <a href="https://www.cinemablend.com/movies/actors-with-stand-up-or-sketch-comedy-experience">starred on a sketch comedy series</a> called <em>Fridays</em> and very briefly wrote for <em>SNL</em> before going on to play himself on an entertainment industry satire he created, much like when former <em>SNL</em> actor Pete Davidson created and starred in the semi-autobiographical <em>Bupkis</em> for Peacock.</p><p><strong>How to watch Bupkis</strong></p><ul><li><a href="https://www.peacocktv.com/watch/asset/tv/bupkis/7868861300673884112"><strong>Stream Bupkis on Peacock</strong></a></li></ul><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="KpCnbKaZswYWzHFhsXQjWk" name="dave (1).jpg" alt="Lil Dicky on DAVE" src="https://cdn.mos.cms.futurecdn.net/KpCnbKaZswYWzHFhsXQjWk.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: FX)</span></figcaption></figure><h2 id="dave-2020-present">Dave (2020-Present)</h2><p><strong>Starring:</strong> Dave “Lil Dicky” Burd, Andrew Santino</p><p><strong>What it's about:</strong> The personal and professional struggles of an up-and-coming rapper who rhymes with a sense of humor.</p><p><strong>Why it is a great show for Curb Your Enthusiasm fans:</strong> Another great example of a funny series starring a comedian as a fictionalized version of himself (and one who often struggles with his own neuroses) is FXX’s <em>Dave</em>, which “Lil Dicky” co-created with Jeff Schaffer.</p><p><strong>How to watch Dave</strong></p><ul><li><a href="https://www.hulu.com/series/ac3a96f0-9614-46af-b524-f59c7d281946"><strong>Stream Dave on Hulu</strong></a></li><li><strong></strong><a href="https://www.amazon.com/Dave-Season-1/dp/B08528P13T"><strong>Buy Dave on Amazon</strong></a></li></ul><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="QMBK7Vz8VpdnFBcLFUmedB" name="vincestaplesonthevincestapleshow-id_313526b1-6290-4c02-aa23-00d82b557e11.jpeg" alt="Vince Staples on The Vince Staples Show" src="https://cdn.mos.cms.futurecdn.net/QMBK7Vz8VpdnFBcLFUmedB.jpeg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="the-vince-staples-show-2024">The Vince Staples Show (2024)</h2><p><strong>Starring:</strong> Vince Staples</p><p><strong>What it's about:</strong> The bizarre encounters of rapper and actor Vince Staples.</p><p><strong>Why it is a great show for Curb Your Enthusiasm fans:</strong> Yet another recent comedy series starring a hip hop artist as a fictionalized version of himself is Netflix’s <em>The Vince Staples Show</em>, which the eponymous star co-created with Ian Edelman and Maurice Williams.</p><p><strong>How to watch The Vince Staples Show</strong></p><ul><li><a href="https://www.netflix.com/title/81264943"><strong>Stream The Vince Staples Show on Netflix</strong></a></li></ul><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="a47k2HTaFQZjw5sSBf4GA" name="Screenshot (1064).png" alt="Some of the main cast of Flight of the Conchords." src="https://cdn.mos.cms.futurecdn.net/a47k2HTaFQZjw5sSBf4GA.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: HBO)</span></figcaption></figure><h2 id="flight-of-the-conchords-2007-2010">Flight Of The Conchords (2007-2010)</h2><p><strong>Starring:</strong> Jemaine Clement, Bret McKenzie</p><p><strong>What it's about:</strong> Two folk artists from New Zealand struggle to make it in the music business and find love while living in New York City.</p><p><strong>Why it is a great show for Curb Your Enthusiasm fans:</strong> An acclaimed comedy series created by and starring a pair of musical comedians is HBO’s <em>Flight of the Conchords</em>, which is also the name of Clement and McKenzie's folk parody duo whose music is featured in each episode.</p><p><strong>How to watch Flight of the Conchords</strong></p><ul><li><a href="https://play.max.com/show/5f5ba394-4784-4edf-9008-af49e3503c28"><strong>Stream Flight Of The Conchords on Max</strong></a></li><li><strong></strong><a href="https://www.amazon.com/Flight-Conchords-Season-1/dp/B006GLMY8S"><strong>Buy Flight Of The Conchords on Amazon</strong></a></li><li><strong></strong><a href="https://www.amazon.com/Flight-Conchords-Complete-Collection/dp/B003L7DK74"><strong>Buy Flight Of The Conchords on DVD on Amazon</strong></a></li></ul><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="9fShEDfWS4zb9adXBH4ZXU" name="entourageadriangrenier.jpg" alt="Adrian Grenier on Entourage" src="https://cdn.mos.cms.futurecdn.net/9fShEDfWS4zb9adXBH4ZXU.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: HBO)</span></figcaption></figure><h2 id="entourage-2004-2011">Entourage (2004-2011)</h2><p><strong>Starring:</strong> Adrian Grenier, Jeremy Piven</p><p><strong>What it's about:</strong> With his close friends and demanding agent by his side, a movie star navigates the highs and lows of the celebrity lifestyle in Los Angeles.</p><p><strong>Why it is a great show for Curb Your Enthusiasm fans:</strong> While none of the central characters of <em>Entourage</em> are real people (despite being <a href="https://www.cinemablend.com/television/funniest-cameos-on-entourage">loosely inspired by producer Mark Wahlberg’s life</a>), it is an acclaimed, Emmy-winning HBO original entertainment satire that often features celebrities appearing as themselves, much like <em>Curb</em>.</p><p><strong>How to watch Entourage</strong></p><ul><li><a href="https://play.max.com/show/358c8a40-65d1-4f88-a5f4-bf5b5c61963e"><strong>Stream Entourage on Max</strong></a></li><li><strong></strong><a href="https://www.amazon.com/Entourage-Season-1/dp/B003OURXD0"><strong>Buy Entourage on Amazon</strong></a></li><li><strong></strong><a href="https://www.amazon.com/Entourage-Complete-Blu-ray-Kevin-Connolly/dp/B008BLCTOU"><strong>Buy Entourage on Blu-ray on Amazon</strong></a></li></ul><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="dytuxPJuAUJNk6uNLK2yT8" name="garryshandlingthelarrysandersshow.jpg" alt="Garry Shandling on The Larry Sanders Show" src="https://cdn.mos.cms.futurecdn.net/dytuxPJuAUJNk6uNLK2yT8.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: HBO)</span></figcaption></figure><h2 id="the-larry-sanders-show-1992-1998">The Larry Sanders Show (1992-1998)</h2><p><strong>Starring:</strong> Garry Shandling, Jeffrey Tambor</p><p><strong>What it's about:</strong> A behind-the-scenes look at the personal and professional life of a late night talk show show host and his dysfunctional colleagues.</p><p><strong>Why it is a great show for Curb Your Enthusiasm fans:</strong> Created by Shandling with Dennis Klein, <em>The Larry Sanders Show</em> is yet another Emmy-winning HBO original entertainment industry satire featuring cameos by celebrities as guests on the eponymous in-universe talk show.</p><p><strong>How to watch The Larry Sanders Show</strong></p><ul><li><a href="https://play.max.com/show/576e149d-8211-46dd-be88-e97fa9e01ac4"><strong>Stream The Larry Sanders Show on Max</strong></a></li><li><strong></strong><a href="https://www.amazon.com/Larry-Sanders-Show-Season/dp/B001S23MUE"><strong>Buy The Larry Sanders Show on Amazon</strong></a></li><li><strong></strong><a href="https://www.amazon.com/Larry-Sanders-Show-Complete/dp/B00V5JEJ1Q"><strong>Buy The Larry Sanders Show on DVD on Amazon</strong></a></li></ul><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="wWYZmVt2NBGBw9Yafomxtd" name="bojack-horseman-season-5-1569610502396.png" alt="BoJack in BoJack Horseman" src="https://cdn.mos.cms.futurecdn.net/wWYZmVt2NBGBw9Yafomxtd.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="bojack-horseman-2014-2020-3">Bojack Horseman (2014-2020)</h2><p><strong>Starring:</strong> Will Arnett, Amy Sedaris</p><p><strong>What it's about:</strong> An anthropomorphic horse actor struggles to come to terms with his dwindling popularity years after the end of his hit sitcom.</p><p><strong>Why it is a great show for Curb Your Enthusiasm fans:</strong> One of the <a href="https://www.cinemablend.com/television/the-75-best-animated-TV-shows-of-all-time">all-time best animated TV shows</a>, Netflix’s <em>BoJack Horseman</em>, is one of the few cartoons that qualify for this list, given that it is yet another Emmy-nominated show business satire with a neurotic protagonist and frequent celebrity cameos.</p><p><strong>How to watch Bojack Horseman</strong></p><ul><li><a href="https://www.netflix.com/title/70300800"><strong>Stream Bojack Horseman on Netflix</strong></a></li></ul><p>If you love <em>Curb Your Enthusiasm</em>, we hope you also find these to be pretty, pretty, pretty good.</p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ 32 TV Characters With Arcs So Good, They Became Fan-Favorites ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/tv-characters-with-arcs-so-good-they-became-fan-favorites</link>
                                                                            <description>
                            <![CDATA[ There are some TV characters that have truly stood the test of time thanks to their fantastic character arcs. Let's talk about them. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">wiRdYHhkbLoS9J8FYEE3wc</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/URNQaKfkFTcJ86BWJrpjQC-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Tue, 19 Mar 2024 01:34:38 +0000</pubDate>                                                                                                                                                                                                                                <category><![CDATA[Television]]></category>
                                                                                                                    <dc:creator><![CDATA[ Alexandra Ramos ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/4vCq2c3J9ZiZUXQ3hPz69T.png ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Alexandra Ramos is a Content Producer at CinemaBlend. She first started off working in December 2020 as a Freelance Writer after graduating from the Pennsylvania State University with a degree in Journalism and a minor in English. She later moved over to full-time in July of 2021, and primarily works in features for movies, TV, and sometimes video games. She is also the main person who runs both our daily newsletter, The CinemaBlend Daily, and our ReelBlend newsletter that is sent out bi-weekly to patrons.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;
&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What She&#039;s Into&lt;/strong&gt;: Alex is into many things. She loves all kinds of movies except for super sappy romantic ones - with the only redeeming case being The Notebook, and is a big fantasy nerd. She’s a huge fan of the streaming shows that have been released, and loves to watch series’ like The Witcher, Shadow &amp;amp; Bone, and more. Her all-time favorite TV show has to be a solid three-way tie between Breaking Bad, Game of Thrones and Attack on Titan - she just can’t seem to pick one. Alex is also a big Marvel nerd, and will defend Scarlet Witch until her dying day. For years, she’s been an avid gamer, primarily for the PlayStation, and has become a part of the fanbase for games like The Last Of Us, God of War, Spider-Man, and more, but that won’t stop her from playing simple games like Animal Crossing, or FPS’ like Call of Duty. Alex is also a big sports fan and considers herself a couchside coach because she will threaten to throw stuff at her TV if Penn State or the NY Giants are losing (which is often), usually with pizza in her hands.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What She&#039;s Excited About Right Now&lt;/strong&gt;: The Boys Season 4 and its spinoff, Gen V Season 2, House of the Dragon Season 2, The Bear Season 4, Fallout, and Bridgerton Season 3 because I&#039;m missing my steamy romance.&amp;nbsp;&lt;/p&gt; ]]></dc:description>
                                                                                                                                <cf:isSponsored>false</cf:isSponsored>
                <cf:hasAffiliateLinks>false</cf:hasAffiliateLinks>
                <cf:isPaid>false</cf:isPaid>
                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/URNQaKfkFTcJ86BWJrpjQC-1280-80.jpg">
                                                            <media:credit><![CDATA[Nickelodeon]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[Zuko as the Fire Lord in Avatar: The Last Airbender.]]></media:description>                                                            <media:text><![CDATA[Zuko as the Fire Lord in Avatar: The Last Airbender.]]></media:text>
                                <media:title type="plain"><![CDATA[Zuko as the Fire Lord in Avatar: The Last Airbender.]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/URNQaKfkFTcJ86BWJrpjQC-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>I don&apos;t know about you, but I <em>love </em>a good character arc. Whether it&apos;s someone bad turning good, someone good turning bad, or just a character growing up and maturing over time, a good character arc makes a TV show a million times better. </p><p>Don&apos;t forget that a good character arc also makes fans favorites, and these characters certainly became major fan favorites after their well-deserved character arcs on their television shows. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="69twVFjHkffCjj9ZWg5w2h" name="SchittsCreekAlexis.png" alt="Alexis breaking up with Ted in Schitt's Creek" src="https://cdn.mos.cms.futurecdn.net/69twVFjHkffCjj9ZWg5w2h.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Canadian Broadcasting Corporation)</span></figcaption></figure><h2 id="alexis-schitt-apos-s-creek">Alexis (Schitt&apos;s Creek)</h2><p>The <a href="https://www.cinemablend.com/television/2569420/schitts-creek-what-to-watch-if-youre-missing-the-cast-of-the-hilarious-comedy"><u><em>Schitt&apos;s Creek </em></u><u>cast</u></a> is incredibly talented in many ways, but everyone had a better character arc than Alexis. Starting as a pretty, spoiled girl who didn&apos;t have a clear direction in life, she seriously matures toward the end of the series and begins to figure out what she wants – through hilarious moments. However, it&apos;s still a great character arc. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="qk7HoANFtMicCxDiQFyLZ7" name="MV5BNzhiNThlMTktMTkyNi00ZjEyLWJhNzctZTk0ODM4MTk3Y2VlXkEyXkFqcGdeQXVyMjgyOTI4Mg@@._V1_ (1).jpg" alt="Zuko facing off against Aang in Avatar: The Last Airbender." src="https://cdn.mos.cms.futurecdn.net/qk7HoANFtMicCxDiQFyLZ7.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Nickelodeon)</span></figcaption></figure><h2 id="zuko-avatar-the-last-airbender">Zuko (Avatar: The Last Airbender)</h2><p>It&apos;s well-known that <a href="https://www.cinemablend.com/television/2572237/avatar-the-last-airbender-reasons-why-zuko-one-of-the-best-character-arcs-on-tv"><u>Zuko has one of the most significant character arcs</u></a> of all time, especially in television, but most definitely in <em>Avatar: The Last Airbender. </em></p><p>Starting as a banished prince, Zuko had to undergo serious self-reflection, punishment, and much more to realize his true destiny. In the end, he was willing to sacrifice his life for the Avatar and his friends rather than try and earn the honor of his father over and over again. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="9bx4JSj2WdJX9MCD39Q7nY" name="lokiseason2finale.jpg" alt="Tom Hiddleston  on Loki" src="https://cdn.mos.cms.futurecdn.net/9bx4JSj2WdJX9MCD39Q7nY.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Marvel Studios)</span></figcaption></figure><h2 id="loki-loki">Loki (Loki)</h2><p>Loki is a curious character because he had character arcs in both the Marvel Cinematic Universe and the <em>Loki </em>television show, but we&apos;ll talk specifically about the series. </p><p>Throughout its two seasons, Loki changes immensely, from the villain he was at the end of the first <em>Avengers </em>film to someone who would lock himself away forever to ensure his friends survive in timelines and keep the universe intact. I mean, talk about a change. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="C5btkotFj8SokaFkzwUFx4" name="BreakingBadSeason1.png" alt="Bryan Cranston in Breaking Bad Episode 1" src="https://cdn.mos.cms.futurecdn.net/C5btkotFj8SokaFkzwUFx4.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: AMC)</span></figcaption></figure><h2 id="walter-white-breaking-bad">Walter White (Breaking Bad)</h2><p>We could say that Walter White had one of the best character arcs ever on television. <em>Breaking Bad </em>was an incredible show for many reasons, but I think the <a href="https://www.cinemablend.com/television/2555856/what-the-breaking-bad-cast-is-doing-now"><u><em>Breaking Bad </em></u><u>cast </u></a>was one of the main things that made it fantastic, including that of Bryan Cranston as White. </p><p>In the beginning, we can almost see White as a savior, desperate to do anything to help his family after his inevitable death from cancer. Still, over time, we see how he changes into this power-hungry fool, ostracizing himself from his life and the people he loves. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="8nuXWP3UUXFxjE4d3DNSWi" name="John Silver, Black Sails.jpg" alt="John Silver in Black Sails." src="https://cdn.mos.cms.futurecdn.net/8nuXWP3UUXFxjE4d3DNSWi.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Starz)</span></figcaption></figure><h2 id="john-silver-black-sails">John Silver (Black Sails)</h2><p><em>Black Sails </em>is one of the best pirate shows, and John Silver was one of the best characters. I mean, think about it – he started off with nothing, just working as a cook due to being captured and taking out another cook. Silver had a brilliant mind, and through the show, we see him turn into a great strategist behind Captain Flint. He was always able to find a way out of any issue, making him more interesting. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="PUHraxpa9BPGKyaSt6wb2J" name="Game Of Thrones Cast-6.jpg" alt="Nikolaj Coster-Waldau in Game of Thrones" src="https://cdn.mos.cms.futurecdn.net/PUHraxpa9BPGKyaSt6wb2J.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: HBO)</span></figcaption></figure><h2 id="jamie-lannister-game-of-thrones">Jamie Lannister (Game Of Thrones)</h2><p>For years, I have considered Jaime Lannister one of the best character arcs on television. As part of the <a href="https://www.cinemablend.com/television/2471230/game-of-thrones-characters-then-and-now"><u><em>Game of Thrones </em></u><u>cast,</u></a> Jaime Lannister was as selfish as a Lannister could be when the series started and then began to change throughout the following seasons, fighting for what was right, denying his sister, and so much more. Let&apos;s ignore what happened in Season 8 of the show. He was still a great character – just not his sad death. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="FPgr7MNAowUpfEWX3LSZzM" name="Octavia, The 100.jpg" alt="Octavia in The 100." src="https://cdn.mos.cms.futurecdn.net/FPgr7MNAowUpfEWX3LSZzM.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: The CW)</span></figcaption></figure><h2 id="octavia-the-100">Octavia (The 100)</h2><p>Good <em>god, </em>I remember when I first watched Octavia, a character a part of <a href="https://www.cinemablend.com/television/2568965/what-the-100-cast-is-doing-now"><u><em>The 100 </em></u><u>cast,</u></a> I could not stand her. She was bratty, selfish, and straight-up annoying. </p><p>But it wasn&apos;t long before she began to mature, and sooner or later, she learned how to fight, lead, and kill, which is <em>needed </em>in this world. What makes her even better is that she&apos;s a flawed character at best—she has moments of morally grey instances that really make you either root for her or hate her—which is why she&apos;s a fan-favorite. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.33%;"><img id="rYUChbknFg9DPYqFoT7ZcN" name="Bob Odenkirk.png" alt="Bob Odenkirk as Jimmy McGill / Saul Goodman" src="https://cdn.mos.cms.futurecdn.net/rYUChbknFg9DPYqFoT7ZcN.png" mos="" align="middle" fullscreen="" width="1280" height="721" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: AMC)</span></figcaption></figure><h2 id="jimmy-mcgill-better-call-saul">Jimmy McGill (Better Call Saul)</h2><p>Oh, Jimmy McGill. <em>Better Call Saul </em>was a spinoff of <em>Breaking Bad </em>and told the story of Jimmy McGill or Saul Goodman. He started as someone genuinely trying to make it as a lawyer, but as the seasons go on, we see him sink more into criminal activity to get ahead since no one would give him a chance, thanks to his past. It&apos;s a slow, depressing character arc, but it&apos;s still fantastic either way.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="QqdbDUGkEfobkmYaqFYBgk" name="brett goldstein.jpg" alt="Brett Goldstein on Ted Lasso" src="https://cdn.mos.cms.futurecdn.net/QqdbDUGkEfobkmYaqFYBgk.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Apple TV+)</span></figcaption></figure><h2 id="roy-kent-ted-lasso">Roy Kent (Ted Lasso)</h2><p>He&apos;s here, he&apos;s there, he&apos;s every-well, you know the chant. </p><p>Roy Kent of <em>Ted Lasso </em>began the series as a crude, mean, and old (in the eyes of sports) man, bitter about his past and despising Lasso coming in as their coach. But through the help of his close friends, significant others, and more, we see how much of a heart he has. He starts to show his true colors, and sooner or later, we see him even making friends with Jamie Tartt.  </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="ZkAZiTe75Shgf8UsRJytPT" name="TWD_1115_JD_0917_0398-RT.jpg" alt="daryl in black shirt in The Walking Dead" src="https://cdn.mos.cms.futurecdn.net/ZkAZiTe75Shgf8UsRJytPT.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: AMC)</span></figcaption></figure><h2 id="daryl-dixon-the-walking-dead">Daryl Dixon (The Walking Dead)</h2><p>Out of everyone on <em>The Walking Dead, </em>I think Daryl Dixon&apos;s character arc is among the most intriguing and fun to witness. When we first meet Daryl, he&apos;s super selfish and only cares about himself and his brother, but by the end of the series, he has a family, a life, and so much more that he&apos;s willing to die for. He was so beloved that there was a phrase called, "If Daryl Dies, We Riot." I would know, I had a shirt that said it.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="pEnRuEkMjMtuTtbfmDDqHc" name="diane-nguyen (1).jpg" alt="Alison Brie voices Diane in BoJack Horseman." src="https://cdn.mos.cms.futurecdn.net/pEnRuEkMjMtuTtbfmDDqHc.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="diane-nguyen-bojack-horseman">Diane Nguyen (BoJack Horseman)</h2><p><em>BoJack Horseman </em>focuses on so many traumatized characters, but one of the best they really did a good character on is Diane Nguyen. She starts off as BoJack&apos;s ghost-writer, and while she&apos;s a bit passive at first, we start to see her grow into herself as time passes, confronting her past and future and even dealing with her own mental issues. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="pAGvqDbGfGrceutDfcQLpg" name="StrangerThings_StrangerThings4_8_01_04_58_01.jpg" alt="Joe Keery as Steve Harrington in Stranger Things Season 4" src="https://cdn.mos.cms.futurecdn.net/pAGvqDbGfGrceutDfcQLpg.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="steve-harrington-stranger-things">Steve Harrington (Stranger Things)</h2><p>I&apos;m pretty sure everyone during the first season of <em>Stranger Things </em>was not the biggest fan of Steve, played by <a href="https://www.cinemablend.com/movies/where-stranger-things-fans-will-be-able-to-watch-joe-keery-next-before-season-5-hits-netflix"><u>the excellent Joe Keery</u></a>. But of course, we all ended up loving Steve Harrington because he learned to care for others and also became the best babysitter ever for the kids we loved. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="bxBZPnu9yuEdSZ8ssJseLb" name="virgins.jpg" alt="Schmidt, Nick, and Winston on New Girl" src="https://cdn.mos.cms.futurecdn.net/bxBZPnu9yuEdSZ8ssJseLb.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Fox)</span></figcaption></figure><h2 id="nick-new-girl">Nick (New Girl)</h2><p>I could do any of the boys from the apartment, but Nick began <em>New Girl </em>as the type of guy I don&apos;t think any girl would want. He was immature and didn&apos;t have any direction in life. But towards the end of the series, even if he was still silly, he committed to fixing his life, growing stronger bonds with others, and opening up about his feelings instead of keeping it all closed inside. You have to love him. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="pdrJbHhMuJC97QzauHN83W" name="TWD_1101_JS_0208_1227_RT (1).jpg" alt="Carol in The Walking Dead." src="https://cdn.mos.cms.futurecdn.net/pdrJbHhMuJC97QzauHN83W.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: AMC)</span></figcaption></figure><h2 id="carol-the-walking-dead">Carol (The Walking Dead)</h2><p><a href="https://www.cinemablend.com/television/the-walking-deads-carol-a-timeline-of-major-events-for-the-character"><u>Carol&apos;s timeline on </u><u><em>The Walking Dead</em></u></a> is something special. Her character arc makes me smile every time I think about it. Carol began the show as an abused wife of a beating husband, but once he&apos;s gone, she begins to get stronger <em>every </em>season, becoming a kick-butt zombie slayer and doing anything to protect the ones she loves. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="BxWDn5BM9CMEVLWnt9vx86" name="THBY_S3_UT_305_210527_SAVJAS_00131_1.JPG" alt="Erin Moriarty as Starlight in a press image of The Boys Season 3." src="https://cdn.mos.cms.futurecdn.net/BxWDn5BM9CMEVLWnt9vx86.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Prime Video)</span></figcaption></figure><h2 id="starlight-the-boys">Starlight (The Boys)</h2><p>Starlight from <em>The Boys </em>is the epitome of the phrase "never meet your heroes," literally in the sense of this show. She joins The Seven with bright ideas and discovers that it&apos;s not all it&apos;s cracked up to be. Over the course of three seasons so far, she&apos;s truly stood out and tried to make change—even going as far as breaking the law to do so. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="9KS4RYjL2sTucLXmWSDAsF" name="jamie tartt.jpg" alt="Phil Dunster as Jamie Tartt smiling and looking to the left." src="https://cdn.mos.cms.futurecdn.net/9KS4RYjL2sTucLXmWSDAsF.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Apple TV+)</span></figcaption></figure><h2 id="jamie-tartt-ted-lasso">Jamie Tartt (Ted Lasso)</h2><p>Jamie Tartt from <em>Ted Lasso </em>was so immature and selfish when we first met him, but he gets his time to shine in Seasons 2 and 3, where we start to see him change. He begins to grow and understand his role as a leader, making amends with old rivals and past relationships and building new bonds. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="4Ay2diSdc7EtNvERUEtgzF" name="clarke and lexa the 100.jpg" alt="Clarke and Lexa on The 100 looking up." src="https://cdn.mos.cms.futurecdn.net/4Ay2diSdc7EtNvERUEtgzF.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: The CW)</span></figcaption></figure><h2 id="lexa-the-100">Lexa (The 100)</h2><p>While Lexa wasn&apos;t in the series for <em>nearly </em>as long as she should have been, she was an impactful character in <em>The 100. </em>Lexa&apos;s character arc, from being Clarke&apos;s enemy to doing a full 180 and becoming her lover before her tragic demise, will haunt every <em>The 100 </em>fan. This reminds us of all the great &apos;enemies to lovers&apos; movies. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="8SixYjhVVYgtjPPQFw4Htb" name="jdm.jpg" alt="Negan outdoors in the Walking Dead" src="https://cdn.mos.cms.futurecdn.net/8SixYjhVVYgtjPPQFw4Htb.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: AMC)</span></figcaption></figure><h2 id="negan-the-walking-dead">Negan (The Walking Dead)</h2><p><a href="https://www.cinemablend.com/television/2572224/the-walking-dead-reasons-why-negan-is-one-of-the-best-characters-on-tv-right-now"><u>Negan was one of the best characters on TV</u></a> when he appeared on <em>The Walking Dead. </em>His character arc not only made him stand out but also made him an easy fan favorite. Clearly one of the franchise&apos;s antagonists from the very beginning, Negan ended up finding his morally grey middle line and helping his once-enemies while also learning to find people to truly love and care about. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="ZY9rYNerG5i3evg2kFqvsL" name="Rosario Dawson as Ahsoka.png" alt="Rosario Dawson as Ashoka Tano" src="https://cdn.mos.cms.futurecdn.net/ZY9rYNerG5i3evg2kFqvsL.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Lucasfilm)</span></figcaption></figure><h2 id="ahsoka-the-star-wars-franchise">Ahsoka (The Star Wars Franchise)</h2><p>Ahsoka was one of the most hated characters in the <em>Star Wars </em>franchise when she first debuted because many thought her immature. Years later, through the <em>Clone Wars </em>and the <a href="https://www.cinemablend.com/star-wars/every-disney-star-wars-show-so-far-ranked"><u>Disney+ </u><u><em>Star Wars </em></u><u>shows,</u></a> she matured into a Jedi master, was calm and collected, and was one of the most versatile warriors out there.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="GvqU8PJMLPc2KK245FPsxW" name="TIU finale Big three.jpg" alt="Kevin, Kate and Randall on This Is Us." src="https://cdn.mos.cms.futurecdn.net/GvqU8PJMLPc2KK245FPsxW.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="the-big-three-this-is-us">The Big Three (This Is Us)</h2><p>As someone who loves the <a href="https://www.cinemablend.com/television/this-is-us-cast-where-youve-seen-the-actors-before"><u><em>This is Us </em></u><u>cast</u></a>, the Big Three certainly had some of the best character arcs. These three go through so many heartbreaking hardships and moments throughout the franchise that it&apos;s a miracle they turn out fine by the end. </p><p>But they didn&apos;t just end up surviving – they faced some of their worst moments, from drug addiction to racism to body issues to so much more, and came out on top. That&apos;s a character to root for – well, <em>three </em>characters in this case. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="M8X6svJLeR62Uny9JFbwFc" name="Lydia, Teen Wolf.jpg" alt="Lydia in Teen Wolf." src="https://cdn.mos.cms.futurecdn.net/M8X6svJLeR62Uny9JFbwFc.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: MTV)</span></figcaption></figure><h2 id="lydia-teen-wolf">Lydia (Teen Wolf)</h2><p>There are plenty of great supernatural teen dramas with superb casts, but Lydia from <em>Teen Wolf </em>certainly has the best character arc. She starts as a popular girl who only cares about herself embraces her powers, and helps her friends down the line with whatever they need, even risking her life on multiple occasions. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="YwWmrzjCqk9H8BBnnYhySo" name="I May Destroy You.jpg" alt="Arabelle in I May Destroy You." src="https://cdn.mos.cms.futurecdn.net/YwWmrzjCqk9H8BBnnYhySo.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: HBO)</span></figcaption></figure><h2 id="arabelle-i-may-destroy-you">Arabelle (I May Destroy You)</h2><p><em>I May Destroy You </em>is a miniseries, but Arabelle&apos;s character arc is top-tier. Through nine episodes, we see Arabelle face one of her darkest and loneliest moments as she tries to figure out who sexually assaulted her one night, and she must face her grief, trauma, and so much more to find inner peace towards the end. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="UDh84pTx6fxiL3GNmG6nwh" name="Eren.jpg" alt="Eren Yeager in Attack on Titan" src="https://cdn.mos.cms.futurecdn.net/UDh84pTx6fxiL3GNmG6nwh.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Crunchyroll)</span></figcaption></figure><h2 id="eren-yeager-attack-on-titan">Eren Yeager (Attack On Titan)</h2><p>There are plenty of character arcs in anime, but the one I have to do is Eren Yeager from <em>Attack on Titan. </em>He started off this anime as a brat who only wanted to kill Titans and would do anything to achieve it, but towards the end, he wound up becoming one of the most complex anime characters out there, with deep, hidden intentions and feelings that we could barely comprehend. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="8qU4PT5s4sWT6DK3yDbmKn" name="Untitled design - 2022-03-24T105238.543.png" alt="Kristen Bell as Eleanor Shellstrop in The Good Place" src="https://cdn.mos.cms.futurecdn.net/8qU4PT5s4sWT6DK3yDbmKn.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="eleanor-shellstrop-the-good-place">Eleanor Shellstrop (The Good Place)</h2><p>Out of the many characters in <em>The Good Place, </em>I have to give the character arc award to Eleanor. Her whole journey in the afterlife literally begins with a lie and being super selfish, but towards the end, she is filled with wisdom and selflessness and is willing to fight for what is right. It&apos;s a beautiful story. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="zNCsMhPdYR6oBs83TWZk8K" name="Bubbles in The Wire.jpg" alt="Bubbles in The Wire." src="https://cdn.mos.cms.futurecdn.net/zNCsMhPdYR6oBs83TWZk8K.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: HBO)</span></figcaption></figure><h2 id="bubbles-the-wire">Bubbles (The Wire)</h2><p>Surprisingly<em>, The Wire </em>is a show that has <a href="https://www.cinemablend.com/television/great-tv-shows-that-never-won-best-series-at-the-emmys"><u>never won Best Drama at the Emmys</u></a>, but it should have these character arcs, and I have to give it to Bubbles. One of the <em>show&apos;s many characters</em>, Bubbles&apos; road to recovery, made you want to root for him from the very beginning and support him no matter what. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="aoPfkFncjYtkCgwLJsqjqT" name="0df6d4af-sokka.jpg" alt="Sokka in Avatar: The Last Airbender" src="https://cdn.mos.cms.futurecdn.net/aoPfkFncjYtkCgwLJsqjqT.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Nickelodeon Animation Studio)</span></figcaption></figure><h2 id="sokka-avatar-the-last-airbender">Sokka (Avatar: The Last Airbender)</h2><p>Sokka was probably one of the most misogynistic characters in <em>Avatar: The Last Airbender. At first, he believed</em> that women could not fight, but towards the end of the series, he becomes a valuable leader, leading both men and women and becoming the man he was always meant to be. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="aKzS97Vmey5JfGbrVNcxFJ" name="Game Of Thrones Cast-7.jpg" alt="Sophie Turner in Game of Thrones" src="https://cdn.mos.cms.futurecdn.net/aKzS97Vmey5JfGbrVNcxFJ.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: HBO)</span></figcaption></figure><h2 id="sansa-stark-game-of-thrones">Sansa Stark (Game Of Thrones)</h2><p>I know for a fact that many people did not like Sansa in the first few seasons of <em>Game of Thrones, </em>but she had some <em>serious </em>character growth that turned her into a fan favorite. From spoiled brat to Queen of the North, Sansa&apos;s maturity shines through. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="oVAGLJZhBmfbVtxzAnjCnc" name="Buffy the Vampire Slayer S6 Ep3A.jpg" alt="James Marsters in Buffy" src="https://cdn.mos.cms.futurecdn.net/oVAGLJZhBmfbVtxzAnjCnc.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: 20th Century Fox Television )</span></figcaption></figure><h2 id="spike-buffy-the-vampire-slayer">Spike (Buffy The Vampire Slayer)</h2><p>Starting as a villain in <em>Buffy the Vampire Slayer, </em>Spike was initially super unlikable. Over time, as he realized there was more than watching everything that went against him fall, he eventually worked with Buffy and became a trustful person.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="yjN6hn6YLKEbKPB7VNe3d3" name="hannah waddingham ted lasso.jpg" alt="A screenshot of Hannah Waddingham looking wide-eyed in Ted Lasso." src="https://cdn.mos.cms.futurecdn.net/yjN6hn6YLKEbKPB7VNe3d3.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Apple TV+)</span></figcaption></figure><h2 id="rebecca-ted-lasso">Rebecca (Ted Lasso)</h2><p>Rebecca&apos;s entire journey began with her as a villain in <em>Ted Lasso,</em> where she specifically hired Ted for the team to do poorly so it would shut down for revenge towards her ex-husband. But she is changed through Ted&apos;s kindness; towards the end, we miss her as much as we miss Ted. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="Pib8vAiPwwUEaaZXvbJLpJ" name="Mad Men Elisabeth Moss.jpg" alt="Elisabeth Moss on Mad Men" src="https://cdn.mos.cms.futurecdn.net/Pib8vAiPwwUEaaZXvbJLpJ.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: AMC)</span></figcaption></figure><h2 id="peggy-olsen-mad-men">Peggy Olsen (Mad Men)</h2><p>Peggy Olsen was a boss, and she wanted you to know. <em>Mad Men </em>was an AMC show that followed advertising executives in NYC, and Peggy was a character who worked her way up in power, beginning as a secretary unaware of the world she was entering and becoming an absolute leader despite her being a woman in the workplace in the 1960s. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="LBjUrTi8koyDHAKRnaywbH" name="Game Of Thrones Cast-8.jpg" alt="Alfie Allen in Game of Thrones" src="https://cdn.mos.cms.futurecdn.net/LBjUrTi8koyDHAKRnaywbH.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: HBO)</span></figcaption></figure><h2 id="theon-greyjoy-game-of-thrones">Theon Greyjoy (Game Of Thrones)</h2><p>While <em>Game of Thrones’ </em>last season had issues, Theon Greyjoy&apos;s character was not one of them. Starting off as selfish and a betrayer who would do anything for power, Theon devotes his life to the Starks&apos; cause in fighting against the Night King and <a href="https://www.cinemablend.com/television/2471941/grading-every-major-game-of-thrones-season-8-death"><u>dies in Season 8</u></a> defending Bran—but he dies a hero. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="bLmYVXX78KavQyPig73Bk3" name="april ludgate.png" alt="Aubrey Plaza in Parks and Recreation." src="https://cdn.mos.cms.futurecdn.net/bLmYVXX78KavQyPig73Bk3.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="april-parks-and-recreation">April (Parks And Recreation)</h2><p>April from the <a href="https://www.cinemablend.com/television/2495456/what-the-parks-and-recreation-cast-members-are-doing-now"><u><em>Parks and Recreation </em></u><u>cast</u></a> really started off as a slacker, but over the course of the series, through the help of her friends, relationships, and more, we start to become a heck of a lot more trusting—and still keeping that same deadpan humor that fans love. </p><p>Which one of these classic fan-favorite character arcs is your favorite? This makes me want to rewatch all these shows again, just for fun. </p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ 32 TV Characters We Never Saw ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/tv-characters-we-never-saw</link>
                                                                            <description>
                            <![CDATA[ These TV characters prove that memorability that does not alway rely on visibility. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">g2XCEWdMFP5KbXBy2CfDA6</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/TZvzYeMuRHuSTxjWNtFEf5-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Thu, 07 Mar 2024 17:34:06 +0000</pubDate>                                                                                                                                                                                                                                <category><![CDATA[Television]]></category>
                                                                                                                    <dc:creator><![CDATA[ Jason Wiese ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/ZWUcQovBZAtQqcvqB5DKQm.png ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Jason Wiese writes feature stories for CinemaBlend. His occupation results from years dreaming of a filmmaking career, settling on a &quot;professional film fan&quot; career, studying journalism at Lindenwood University in St. Charles, MO (where he served as Culture Editor for its student-run print and online publications), and a brief stint of reviewing movies for fun. He would later continue that side-hustle of film criticism on TikTok (@wiesewisdom), where he posts videos on a semi-weekly basis.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;Jason has been writing since he was able to pick up a washable marker, with which he wrote his debut illustrated children&#039;s story, later transitioning to a short-lived comic book series and (very) amateur filmmaking before finally settling on pursuing a career in writing about movies in lieu of making them. Look for his name in almost any article about Batman.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What He&#039;s Into&lt;/strong&gt;: Readers may notice a recurring theme of horror and superhero-related content (especially in regards to Batman) in much of Jason&#039;s work, but his favorite film of all time is more in line with traditional action/adventure stories: &lt;em&gt;Raiders of the Lost Ark&lt;/em&gt;. His favorite TV series is the gritty, grounded crime thriller &lt;em&gt;Breaking Bad&lt;/em&gt; and if you catching him reading anything, it is probably a comic book (and, more often than not, one featuring Batman). More important to him than entertainment, however, are his wife and two dogs.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What He&#039;s Excited About Right Now&lt;/strong&gt;: Jason typically tries to keep his excitement and expectations for any upcoming movies as low as possible, but he is certainly looking forward to the second halves of &lt;em&gt;Spider-Man: Across the Spider-Verse &lt;/em&gt;(&lt;em&gt;Beyond the Spider-Verse&lt;/em&gt;) and &lt;em&gt;Mission: Impossible - Dead Reckoning&lt;/em&gt;, as well as Tim Burton&#039;s long, LONG-awaited follow-up to a very film in his household, &lt;em&gt;Beetlejuice&lt;/em&gt;. However, even more than any of those sequels, he is especially looking forward to returning to Matt Reeves&#039; vision of Gotham City in the upcoming follow-up to &lt;em&gt;The Batman&lt;/em&gt;.&lt;/p&gt; ]]></dc:description>
                                                                                                                                <cf:isSponsored>false</cf:isSponsored>
                <cf:hasAffiliateLinks>false</cf:hasAffiliateLinks>
                <cf:isPaid>false</cf:isPaid>
                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/TZvzYeMuRHuSTxjWNtFEf5-1280-80.jpg">
                                                            <media:credit><![CDATA[NBC]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[Maris&#039; silhouette on Frasier]]></media:description>                                                            <media:text><![CDATA[Maris&#039; silhouette on Frasier]]></media:text>
                                <media:title type="plain"><![CDATA[Maris&#039; silhouette on Frasier]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/TZvzYeMuRHuSTxjWNtFEf5-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>Have you ever been asked to picture your favorite character from your favorite TV show, but no picture came to mind? There is actually no shame in admitting that because we don’t even know what many of our own favorite TV characters look like. Take a <em>look</em> back at some of the most iconic characters on television that we never got any screen time, or were, at least, kept partially hidden.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="9CpNXKfHK8cHLcQVbheaqM" name="charliesangelscharlie.jpg" alt="Charlie's speaker from Charlie's Angels" src="https://cdn.mos.cms.futurecdn.net/9CpNXKfHK8cHLcQVbheaqM.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><h2 id="charlie-townsend-charlie-apos-s-angels">Charlie Townsend (Charlie&apos;s Angels)</h2><p>On <em>Charlie&apos;s Angels</em>, the Angels never physically met their boss, Charlie Townsend, who was voiced by John Forsythe in the original series and the first two cinematic spin-offs. The reason the retired detective never revealed his appearance and only communicated by via intercom was out of protection for his agents.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="GPD2t3RjqKwUjoEaRrjBTk" name="cheers norm.png" alt="Norm in Cheers." src="https://cdn.mos.cms.futurecdn.net/GPD2t3RjqKwUjoEaRrjBTk.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="vera-peterson-cheers">Vera Peterson (Cheers)</h2><p>At Cheers, everyone knew Norm Peterson (George Wendt), but no one knew his wife, Vera… or, at least, what she looked like. She was often mentioned on the long-running, Emmy-winning NBC sitcom, but was rarely seen with her accountant husband, save one time when she was covered by a pie accidentally thrown in her face by Sam (Ted Danson).</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="BSsgZ6Jm2oMSTwiATESVba" name="seinfeldmichaelrichardsbobsacamano.jpg" alt="Michael Richards on Seinfeld" src="https://cdn.mos.cms.futurecdn.net/BSsgZ6Jm2oMSTwiATESVba.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="bob-sacamano-seinfeld">Bob Sacamano (Seinfeld)</h2><p>Outside of the main four <a href="https://www.cinemablend.com/television/1703049/seinfeld-the-cast-then-and-now"><em>Seinfeld</em> cast</a> members, Cosmo Kramer (Michael Richards) had friends like Newman (Wayne Knight) and Mickey Abbott (Danny Woodburn). His one buddy we never met was Bob Sacamano, but the seminal sitcom dropped enough hints in conversation about his scheming behavior and terrible luck that he was just as memorable as the former two.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="KoPmwYgkfCracZE99EXEmk" name="will&gracestanley.jpg" alt="Megan Mullally on Will & Grace" src="https://cdn.mos.cms.futurecdn.net/KoPmwYgkfCracZE99EXEmk.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="stan-walker-will-amp-grace">Stan Walker (Will & Grace)</h2><p>For the first few seasons of <em>Will & Grace</em>, Karen Walker (Megan Mullally) was married to the wealthy Stanley, before his affair, imprisonment, and death hoax caused issues. We never actually saw what the man looked like -- save a few shots of his hands and feet and the outline of his silhouette — but we know he is a heavy-set toupee-wearer.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="eQrjNVGxuUwPC5FThaXPm7" name="TXF Home.png" alt="Gillian Anderson and David Duchovny in the "Home" episode of The X-Files" src="https://cdn.mos.cms.futurecdn.net/eQrjNVGxuUwPC5FThaXPm7.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: 20th Century Fox)</span></figcaption></figure><h2 id="danny-valladeo-the-x-files">Danny Valladeo (The X-Files)</h2><p>While investigating cases on The X-Files, Fox Mulder (David Duchovny) and Dana Scully (Gillian Anderson) would reach out to an FBI agent named Danny. Fans have theorized that this Danny and another unseen character on the hit sci-fi show named Danny Bernstein are the same person, but creator Chris Carter has confirmed that this particular Danny’s last name is “Valladeo.”</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="Y5LJXxCdioyVCsZH5mDqr8" name="Magnum PI tom Selleck Theme.jpg" alt="Tom Selleck on Magnum, PI" src="https://cdn.mos.cms.futurecdn.net/Y5LJXxCdioyVCsZH5mDqr8.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBS)</span></figcaption></figure><h2 id="robin-masters-magnum-p-i">Robin Masters (Magnum P.I.)</h2><p>Even though some <em>Magnum P.I.</em> fans — and Tom Selleck’s titular private investigator himself — suspected John Hillerman&apos;s Johnathan Higgins was the real Robin Masters, the elusive novelist was officially billed as the voice of Orson Welles for six episodes. The character would be expanded in the Jay Hernandez-led modern reboot, in which he employs Magnum as a consultant, but still remains unseen.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="5yDT5mUTfqNr8iBo78as8d" name="maris cover.jpg" alt="David Hyde Pierce and Kelsey Grammer on Frasier" src="https://cdn.mos.cms.futurecdn.net/5yDT5mUTfqNr8iBo78as8d.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="maris-crane-frasier">Maris Crane (Frasier)</h2><p>Originally, <em>Frasier</em> creators David Angell, Peter Casey, and David Lee wanted to, essentially, prank viewers of the <em>Cheers</em> spin-off into thinking Maris Crane was another Vera Peterson (Norm&apos;s unseen wife) before revealing her appearance later on. However, descriptions of Niles&apos; (David Hyde Pierce) wife became so absurd over time that she was ultimately deemed impossible to cast and remained unseen for all 11 seasons.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="SvVW9V25Zt56NfNt2E5zJe" name="1371742285000-James-1306201133_16_9.jpg" alt="James Gandolfini on The Sopranos" src="https://cdn.mos.cms.futurecdn.net/SvVW9V25Zt56NfNt2E5zJe.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: HBO)</span></figcaption></figure><h2 id="ercole-quot-eckley-quot-dimeo-the-sopranos">Ercole "Eckley" DiMeo (The Sopranos)</h2><p>Before Tony Soprano (James Gandolfini) took over as the head of the DiMeo Family Mafia, the syndicate’s longtime leader was Ercole DiMeo, who was otherwise known as "Eckley.”Until he was portrayed by <em>The Sopranos</em> creator David Chase in the 2021 prequel movie, <em>The Many Saints of Newark</em>, Eckley was never seen on the original HBO series, due to his incarceration.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="bHVMuKrfDtior8dWrjU8kh" name="bigbangtheorydebbie.jpg" alt="Simon Helberg and Melissa Rauch on The Big Bang Theory" src="https://cdn.mos.cms.futurecdn.net/bHVMuKrfDtior8dWrjU8kh.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBS)</span></figcaption></figure><h2 id="debbie-wolowitz-the-big-bang-theory">Debbie Wolowitz (The Big Bang Theory)</h2><p>Howard Wolowitz&apos;s overprotective and overly loud mother, Debbie, was voiced by the late Carol Ann Susi on <a href="https://www.cinemablend.com/television/2493771/what-the-big-bang-theory-cast-is-doing-now"><em>The Big Bang Theory</em> cast</a>. It was not until Pamela Adlon portrayed a younger version of the character on <em>Young Sheldon</em> that she made her first official on-screen appearance.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="2KddQPjUL35LXZbV3PrMvG" name="marytylermooreshowclorisleachman.jpg" alt="Cloris Leachman in The Mary Tyler Moore Show" src="https://cdn.mos.cms.futurecdn.net/2KddQPjUL35LXZbV3PrMvG.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBS)</span></figcaption></figure><h2 id="lars-lindstrom-the-mary-tyler-moore-show">Lars Lindstrom (The Mary Tyler Moore Show)</h2><p>On <em>The Mary Tyler Moore Show</em>, Mary’s self-absorbed friend, Phyllis (Academy Award nominee Cloris Leachman), and her dermatologist husband, Lars, were never seen together, despite being married for 15 years at the time the sitcom began. When Phyllis got her own self-titled spin-off in 1975, which lasted two seasons, we never got the chance to finally, officially meet her spouse as he had died by then.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="vZN7Q2UkV7XTGaeNV4dJDi" name="inspectorgadgetdrclaw.jpg" alt="Dr. Claw from Inspector Gadget" src="https://cdn.mos.cms.futurecdn.net/vZN7Q2UkV7XTGaeNV4dJDi.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: DIC)</span></figcaption></figure><h2 id="dr-claw-inspector-gadget">Dr. Claw (Inspector Gadget)</h2><p>Disney&apos;s live-action feature adaptation of <em>Inspector Gadget</em> reimagined the titular half-cop, half-machine’s arch-enemy as a man with an actual claw for a hand, played by Rupert Everett. In the animated series, Dr. Claw had both hands, but that was all we ever saw of the master criminal, who was originally voiced by Frank Welker.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="24unBC7SiGwEBX36Aps26W" name="UNG Outrage.jpg" alt="The cast of Friends." src="https://cdn.mos.cms.futurecdn.net/24unBC7SiGwEBX36Aps26W.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Warner Bros.)</span></figcaption></figure><h2 id="ugly-naked-guy-friends">Ugly Naked Guy (Friends)</h2><p>For obvious reasons, viewers were never allowed a clear view of Monica (Courteney Cox) and Rachel&apos;s (Jennifer Aniston) neighbor from across the street whom, the <a href="https://www.cinemablend.com/television/2474356/what-have-the-friends-cast-been-up-to-since-the-show-ended"><em>Friends</em> cast</a> only referred to as "Ugly Naked Guy." We did, at least, see the back of his head when Ross (David Schwimmer) visited him in hopes of taking his apartment when he moved out.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="EmiBDx5Eag4aREGB9rQgxF" name="degrassiCassieSteeleninadobrev.jpg" alt="Cassie Steele and Nina Dobrev on Degrassi: The Next Generation" src="https://cdn.mos.cms.futurecdn.net/EmiBDx5Eag4aREGB9rQgxF.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBC)</span></figcaption></figure><h2 id="heather-sinclair-degrassi-the-next-generation">Heather Sinclair (Degrassi: The Next Generation)</h2><p>One of the most talked about students at the eponymous high school from <em>Degrassi: The Next Generation</em> was Heather Sinclair. However, despite her notoriety among her classmates, fans of the hit Canadian teen drama never had the chance to put a face to the name.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="5yU7f9CvQFZKaZZEAugTiV" name="seinfeldlenlasserjerryseinfeld.jpg" alt="Len Lasser and Jerry Seinfeld on Seinfeld" src="https://cdn.mos.cms.futurecdn.net/5yU7f9CvQFZKaZZEAugTiV.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="cousin-jeffrey-seinfeld">Cousin Jeffrey (Seinfeld)</h2><p>Fans had the "pleasure" (in some cases, at least) of meeting many of Jerry Seinfeld&apos;s family members on <em>Seinfeld</em>, except for his cousin, Jeffrey. However, some might feel they know him quite well anyway with how often Uncle Leo (Len Lasser) talks about him "like he split the atom" and the main gang’s description of his horse-like face.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="C4qtEpvhPjtGqtxoMZCr9B" name="wilsontgive.jpg" alt="Earl Hindman in the Taylors House on Home Improvement." src="https://cdn.mos.cms.futurecdn.net/C4qtEpvhPjtGqtxoMZCr9B.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><h2 id="wilson-w-wilson-home-improvement">Wilson W. Wilson (Home Improvement)</h2><p>This one is a special case because the Taylors’ next-door neighbor is never completely unseen. For no discernible reason, only the top half of <a href="https://www.cinemablend.com/television/2562297/what-the-home-improvement-cast-is-doing-now-including-tim-allen"><em>Home Improvement</em> cast</a> member Earl Hindman&apos;s face was ever visible, with the bottom half typically hidden behind his fence.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="xa9UwzHeuTzSDCEzAeDCEd" name="Columbo.jpg" alt="Peter Falk in Columbo" src="https://cdn.mos.cms.futurecdn.net/xa9UwzHeuTzSDCEzAeDCEd.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="mrs-columbo-columbo">Mrs. Columbo (Columbo)</h2><p>Peter Falk&apos;s beloved, eponymous detective from <em>Columbo</em> spoke about his wife often but never bothered to show her in public, or at least to the camera. However, the role would be embodied by Kate Mulgrew in <em>Mrs. Columbo</em> — a <a href="https://www.cinemablend.com/television/great-tv-shows-that-had-spin-offs-you-may-have-forgotten-about">spin-off most people have forgotten</a> (or at least would prefer to), which is why we still count the character as unseen.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="bEdmfU366dJriiKmyCc7iV" name="andygriffithandydonknotts.jpg" alt="Andy Griffith and Don Knotts on The Andy Griffith Show" src="https://cdn.mos.cms.futurecdn.net/bEdmfU366dJriiKmyCc7iV.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBS)</span></figcaption></figure><h2 id="juanita-beasley-the-andy-griffith-show">Juanita Beasley (The Andy Griffith Show)</h2><p>Juanita Beasley is a woman whom Barney Fife (Don Knotts) took quite a liking to and would spend a lot of time chatting with over the phone. If only <em>The Andy Griffith Show</em> ever put a camera on her, we might have been able to see the appeal.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="zEEpGg6UoPEsTraJiWJt95" name="bojackhorsemanerica.jpg" alt="Will Arnett and Paul F. Tompkins on Bojack Horseman" src="https://cdn.mos.cms.futurecdn.net/zEEpGg6UoPEsTraJiWJt95.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="erica-bojack-horseman">Erica (Bojack Horseman)</h2><p>Many times on Netflix’s <em>Bojack Horseman</em>, Mr. Peanutbutter (Paul F. Tompkins) would shout off-screen toward someone named “Erica.” Based on what the Labrador Retriever has said about his friend on the <a href="https://www.cinemablend.com/television/the-75-best-animated-TV-shows-of-all-time">acclaimed animated TV show</a>, we know that she has lost a few appendages (but "has the right number of ears") and has been banned from Disneyland. Her true identity and supposedly bizarre appearance remain a mystery.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="wckitM7R6tuuZpdwVRh2zE" name="peanutspeppermintpattcharliebrown.jpg" alt="Peppermint Patty and Charlie Brown on Peanuts" src="https://cdn.mos.cms.futurecdn.net/wckitM7R6tuuZpdwVRh2zE.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBS)</span></figcaption></figure><h2 id="adults-peanuts">Adults (Peanuts)</h2><p>You could say the shorts and TV specials based on Charles Schultz&apos;s <em>Peanuts</em> comic strip made up the ultimate children&apos;s program because the only people you saw were children. Of course, there were some adult characters — such as Charlie Brown&apos;s teacher, Miss Othmar — but they were largely kept offscreen and spoke in a language that could be described as the somber wail of a trombone.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="qFjger4HAEvVSdkF4sbiZa" name="welcomebackkotterepstein.jpg" alt="Robert Hegyes and Gabe Kaplan in Welcome Back, Kotter" src="https://cdn.mos.cms.futurecdn.net/qFjger4HAEvVSdkF4sbiZa.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><h2 id="epstein-apos-s-mother-welcome-back-kotter">Epstein&apos;s Mother (Welcome Back, Kotter)</h2><p>On <em>Welcome Back, Kotter</em>, Juan Epstein (Robert Hegyes) often used notes to get out of homework assignments signed, "Epstein&apos;s Mother," whom, based on the lack of a first name provided, was likely not the one doing the actual signing. The truth may never be revealed since Epstein&apos;s real mother was never given a chance to show herself on the sitcom.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="WPNt8RSFdMY4j65NumZksj" name="veep-e1553779624867-1280x720.jpg" alt="Julia Louis-Dreyfus in Veep." src="https://cdn.mos.cms.futurecdn.net/WPNt8RSFdMY4j65NumZksj.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: HBO)</span></figcaption></figure><h2 id="president-stuart-hughes-veep">President Stuart Hughes (Veep)</h2><p>Julia Louis-Dreyfus&apos; Emmy-winning role as Vice President Selina Meyer might as well have been the Commander in Chief from the beginning of <em>Veep</em>. Her former superior, President Stuart Hughes, is never actually seen in the White House, which makes discussions of his irresponsibility all the more convincing.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="BqNpaKhbyEztgLssCyssrD" name="rhodavalerieharper (1).jpg" alt="Valerie Harper on Rhoda" src="https://cdn.mos.cms.futurecdn.net/BqNpaKhbyEztgLssCyssrD.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBS)</span></figcaption></figure><h2 id="carlton-rhoda">Carlton (Rhoda)</h2><p>When Valerie Harper&apos;s character on <em>The Mary Tyler Moore Show</em>, Rhoda Morgenstern, got her own self-titled spin-off, she had a doorman named Carlton (voiced by series co-developer Lorenzo Music) who was almost exclusively heard through her building&apos;s intercom, save a few glimpses of his arm. The only time the character was fully visible was in a 1980 animated special that depicted his daily tasks.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="4oAH3tGdTgQoRNvoZ98Ys7" name="seinfeldthebubblenboy.jpg" alt="Jason Alexander and Heidi Swedberg on Seinfeld" src="https://cdn.mos.cms.futurecdn.net/4oAH3tGdTgQoRNvoZ98Ys7.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="donald-seinfeld">Donald (Seinfeld)</h2><p>In one of the <a href="https://www.cinemablend.com/television/the-best-seinfeld-episodes-ranked">best <em>Seinfeld</em> episodes</a>, "The Bubble Boy," a visit to a fan of Jerry&apos;s with an immune deficiency ends in disaster when he and George (Jason Alexander) get in a fight over a Trivial Pursuit card misprint. Jon Hayman voiced the memorable one-episode role whose face was never revealed, even after his fight with George causes a puncture to his germ-free enclosure.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="tRQWDm2au4aziCQg5SpsQP" name="urkel-top (1).jpg" alt="Urkel in Family Matters." src="https://cdn.mos.cms.futurecdn.net/tRQWDm2au4aziCQg5SpsQP.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC/CBS)</span></figcaption></figure><h2 id="dr-herb-and-diane-roberta-urkel-family-matters">Dr. Herb and Diane Roberta Urkel (Family Matters)</h2><p>After, almost literally, stealing the show from the rest of the <a href="https://www.cinemablend.com/television/what-the-family-matters-cast-is-doing-now"><em>Family Matters</em> cast</a>, Steve Urkel (Jaleel White) basically adopted the Winslows as his family. Despite his irritating antics, Urkel’s neighbors did seem more welcoming of the squeaky-voiced nerd&apos;s presence than his actual parents, Herb and Diane Roberta, who kept their distance even when their son married Laura (Kellie Shangyne Williams).</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="AW24vT6RU5fhvFAEhhmFSY" name="felicitykerirussell.jpg" alt="Keri Russell on Felicity" src="https://cdn.mos.cms.futurecdn.net/AW24vT6RU5fhvFAEhhmFSY.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Touchstone / The WB)</span></figcaption></figure><h2 id="sally-reardon-felicity">Sally Reardon (Felicity)</h2><p>When Felicity Porter (Keri Russell) starts college, she keeps in touch with a friend from her hometown named Sally Reardon by exchanging tape recordings. Sally&apos;s voice was provided by Janeane Garofalo, but the comedian never showed up to play the very supportive and wisdom-spouting role on camera.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="PfX2MeuVRFTgU3YNY2ALfW" name="muppetbabiesnanny.jpg" alt="Nanny from Muppet Babies" src="https://cdn.mos.cms.futurecdn.net/PfX2MeuVRFTgU3YNY2ALfW.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Jim Henson Productions)</span></figcaption></figure><h2 id="nanny-muppet-babies">Nanny (Muppet Babies)</h2><p>The most we ever saw of the woman who took care of the Muppets&apos; infantile counterparts on <em>Muppet Babies</em> was her legs. At least Nanny (originally voiced by Barbara Billingsley) had a distinct fashion sense that made those appearances memorable.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="4ZRK4tmMRmHt5pT5e3KRdP" name="mysocalledlifetino.jpg" alt="The My So-Called Life cast" src="https://cdn.mos.cms.futurecdn.net/4ZRK4tmMRmHt5pT5e3KRdP.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><h2 id="tino-my-so-called-life">Tino (My So-Called Life)</h2><p>One of the coolest students at Liberty High School who never once made an appearance in class (or off campus) on <em>My So-Called Life</em> was Tino. Plenty of fascinating information was provided about the teen — from his wicked parties to his lead singer position in Jordan Catalano’s band, The Frozen Embryos — but the seminal <a href="https://www.cinemablend.com/television/90s-shows-that-ended-too-soon">‘90s series ended too soon</a> for his official reveal.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="aRAf4SbEZeTXvMK7mHoDe8" name="fullhouseandreabarber.jpg" alt="Andrea Barber on Full House" src="https://cdn.mos.cms.futurecdn.net/aRAf4SbEZeTXvMK7mHoDe8.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><h2 id="mr-and-mrs-gibbler-full-house">Mr. And Mrs. Gibbler (Full House)</h2><p>The TGIF era was filled with characters who just sort of hung out at the central family&apos;s home more than their own, such as Andrea Barber&apos;s Kimmy Gibbler on <em>Full House</em>. Even when Kimmy got married in the finale of Netflix&apos;s <em>Fuller House</em>, giving us a chance to finally meet her mother and father, they never showed up.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="xBwggT4efKeAnFxtJohET4" name="afvenevelopeassistant.jpg" alt="Bob Saget on America's Funniest Home Videos" src="https://cdn.mos.cms.futurecdn.net/xBwggT4efKeAnFxtJohET4.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><h2 id="envelope-assistant-america-apos-s-funniest-home-videos">Envelope Assistant (America&apos;s Funniest Home Videos)</h2><p>In the original incarnation of <em>America&apos;s Funniest Home Videos</em>, the late Bob Saget was handed an envelope revealing that week&apos;s winner by someone who never showed more than their hand to the camera. The host would always be sure to make conversation with the Envelope Assistant by asking what their evening plans were or remarking about a recent change to their wardrobe or physicality.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="iJRMViYZRGm9xcCP84SyXV" name="robloweparksandrec.png" alt="Robe Lowe as Chris in NBC's Parks and Recreation" src="https://cdn.mos.cms.futurecdn.net/iJRMViYZRGm9xcCP84SyXV.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="dr-richard-nygard-parks-and-recreation">Dr. Richard Nygard (Parks And Recreation)</h2><p>Chris Traeger (played by <a href="https://www.cinemablend.com/television/2495456/what-the-parks-and-recreation-cast-members-are-doing-now"><em>Parks and Recreation</em> cast</a> member Rob Lowe) expresses such high praise for his therapist, Dr. Richard Nygard, that it almost seems to border on cultism. Or, perhaps, their close doctor-patient relationship just seems strange and mysterious because we never got to see the man throughout the hit mockumentary sitcom’s run.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="oojisrD52duUZmmdnSEcGj" name="gary-coleman-diffrent-strokes-what-chu-talkin-bout-willis (1).jpg" alt="Gary Coleman in Diff'rent Strokes." src="https://cdn.mos.cms.futurecdn.net/oojisrD52duUZmmdnSEcGj.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC/ABC)</span></figcaption></figure><h2 id="the-gooch-diff-apos-rent-strokes">The Gooch (Diff&apos;rent Strokes)</h2><p>On <em>Diff&apos;rent Strokes</em>, Arnold (Gary Coleman) was tormented on multiple occasions by a kid known only as "The Gooch." The sitcom managed to paint the character as the stuff of legend — like how most youngsters may see their school bullies — by never actually revealing what he looked like.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="dvnzkVkoGFNiweDFswfmNE" name="saluteyourshortsdrkahn.jpg" alt="Dr. Kahn's loudspaker on Salute Your Shorts" src="https://cdn.mos.cms.futurecdn.net/dvnzkVkoGFNiweDFswfmNE.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Nickelodeon)</span></figcaption></figure><h2 id="dr-kahn-salute-your-shorts">Dr. Kahn (Salute Your Shorts)</h2><p>On the classic Nickelodeon series, <em>Salute Your Shorts</em>, Dr. Kahn would frequently make announcements of a positive or disciplinary variety on a loudspeaker to the youngsters at Camp Anawanna. However, that was as far as our interaction would go with the camp director, voiced by series creator Steve Slavkin.</p><p>There is a part of us that still wishes we could have finally seen some of these classic TV characters (or seen them better, at least). Yet, in retrospect, it is their enigmatic presence that makes them so memorable.</p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ The 75 Best Animated TV Shows Of All Time ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/the-75-best-animated-TV-shows-of-all-time</link>
                                                                            <description>
                            <![CDATA[ CinemaBlend's staff went 2D to rank the 75 best animated TV series of all time. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">aDCSiKnEhdEnATHABVXb7k</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/jVa3GjCVtFrmPEYRNyGFNk-1280-80.png" type="image/png" length="0"></enclosure>
                                                                        <pubDate>Thu, 29 Feb 2024 23:30:00 +0000</pubDate>                                                                                                                                                                                                                                <category><![CDATA[Television]]></category>
                                                                                                                    <dc:creator><![CDATA[ Nick Venable ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/TzeQjfZT5cKqHRsEqudtqT.png ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Nick Venable is an Assistant Managing Editor, and the TV Editor. His humble origin story with CinemaBlend began all the way back in the pre-streaming era, circa 2009, as a freelancing DVD reviewer and TV recapper. After rising up through the ranks covering Movies, Nick leapfrogged over to the small screen to cover more and more television news and interviews, eventually taking over the section for the current era. Born in Louisiana and currently living in Texas — Who Dat Nation over America’s Team all day, all night — Nick spent several years in the hospitality industry, and also worked as a 911 operator. And if you ever happened to hear his music or read his comics/short stories, you have his sympathy. His love for his wife and daughters is almost equaled by his love of gasp-for-breath laughter and gasp-for-breath horror. A lifetime spent in the vicinity of a television screen led to his current dream job, as well as his knowledge of too many TV themes and ad jingles.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What He&#039;s Into&lt;/strong&gt;: Nick is one of those people who won’t necessarily insert a Monty Python reference into every conversation, but is still mentally equipped to do so. Beyond such appreciation for surreal UK comedy, Nick also indulges in as much horror splendor as possible, from Stephen King novels to James Tynion IV comics to Freddy Krueger one-liners to all things Mike Flanagan. Throw in a dash of NFL, some 311 and Weird Al, fried crawfish poboys, bourbon, ‘90s-era pro wrestling, crossword puzzles and mystery-driven video games, and baby, you got a stew going. (Nick will insert an Arrested Development reference into every conversation, if possible.)&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What He&#039;s Excited About&lt;/strong&gt;: Anything Jeff Lemire, Tom King and W. Maxwell Prince think of, ever. More of Kelly Reilly’s deliriously fierce performances on Yellowstone. HBO’s The Last of Us. Clone High’s return. Colin Farrell’s Penguin being in every movie/TV show/breakfast cereal.&lt;/p&gt; ]]></dc:description>
                                                                                                        <dc:contributor><![CDATA[ Adam Holmes ]]></dc:contributor>
                                            <dc:contributor><![CDATA[ Adrienne Jones ]]></dc:contributor>
                                            <dc:contributor><![CDATA[ Cody Beck ]]></dc:contributor>
                                            <dc:contributor><![CDATA[ Corey Chichizola ]]></dc:contributor>
                                            <dc:contributor><![CDATA[ Dirk Libbey ]]></dc:contributor>
                                            <dc:contributor><![CDATA[ Eric Eisenberg ]]></dc:contributor>
                                            <dc:contributor><![CDATA[ Erik Swann ]]></dc:contributor>
                                            <dc:contributor><![CDATA[ Heidi Venable ]]></dc:contributor>
                                            <dc:contributor><![CDATA[ Jason Wiese ]]></dc:contributor>
                                            <dc:contributor><![CDATA[ Laura Hurley ]]></dc:contributor>
                                            <dc:contributor><![CDATA[ Mack Rawden ]]></dc:contributor>
                                            <dc:contributor><![CDATA[ Mick Joest ]]></dc:contributor>
                                            <dc:contributor><![CDATA[ Philip Sledge ]]></dc:contributor>
                                            <dc:contributor><![CDATA[ Rich Knight ]]></dc:contributor>
                                            <dc:contributor><![CDATA[ Riley Utley ]]></dc:contributor>
                                            <dc:contributor><![CDATA[ Sean O&#039;Connell ]]></dc:contributor>
                                                                    <cf:isSponsored>false</cf:isSponsored>
                <cf:hasAffiliateLinks>false</cf:hasAffiliateLinks>
                <cf:isPaid>false</cf:isPaid>
                                                                                                                                <media:content type="image/png" url="https://cdn.mos.cms.futurecdn.net/jVa3GjCVtFrmPEYRNyGFNk-1280-80.png">
                                                            <media:credit><![CDATA[Warner Bros., Fox, Harmonious Claptrap Starburns Industries, Disney ]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[The 75 Best Animated Shows Of All Time]]></media:description>                                                            <media:text><![CDATA[The 75 Best Animated Shows Of All Time]]></media:text>
                                <media:title type="plain"><![CDATA[The 75 Best Animated Shows Of All Time]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/jVa3GjCVtFrmPEYRNyGFNk-1280-80.png" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>Animation is one of the earlier moving art forms, and has provided countless artists the means to bring their stories to life, be it through the black-and-white hues of Bosco the Talk-Ink Kid or the multicolored bliss of <em>Fantasia</em>. Toons can be as simple as the Oscar-winning “The Dot and the Line” from legends Chuck Jones and Maurice Noble, or they can be as endlessly complex as <em>Wallace and Gromit</em>’s stop-motion universe. Television has provided audiences with 80 years of memorable projects –- including some <a href="https://www.cinemablend.com/television/saturday-morning-cartoons-that-barely-get-talked-about-anymore"><u>forgotten Saturday morning gems</u></a> — with new shows debuting at a rapid pace, and we’re here to celebrate the very best animated series of all time.</p><p>From classic characters like Mickey Mouse and Fred Flintstone to modern favorites like Monkey D. Luffy and the Belcher family, CinemaBlend’s staff is saluting them all. So join us in paying tribute to the funniest, coolest, smartest, and most moving animated series that have graced our TV screens over the decades.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="JSYXQghkaCHGjY4GQZMn2N" name="" alt="The Jetsons, with his son Elroy!" src="https://cdn.mos.cms.futurecdn.net/JSYXQghkaCHGjY4GQZMn2N.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Hanna-Barbera Productions)</span></figcaption></figure><h2 id="75-the-jetsons">75. The Jetsons</h2><p>Despite being the first show ABC ever broadcast in color, <em>The Jetsons</em> was canceled after a single season and only 24 total episodes. It just couldn’t find the right audience, at least until the reruns started airing on Saturday mornings and an entire generation of kids fell in love with the futuristic setting and zany plotlines. George, Jane, Judy, Elroy, Astro and Rosey eventually became so popular in syndication that more than 20 years after its cancellation, a further fifty-one episodes were produced, as well as a movie. It’s an unconventional success story but perhaps one fitting for a show filled with futuristic tech that hilariously never works as intended.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="oa9quwe67Xe73kJu3Mr98X" name="" alt="Frylock and Metawad side-eyeing Master Shake over his horchata horn on Aqua Teen Hunger Force miniseries" src="https://cdn.mos.cms.futurecdn.net/oa9quwe67Xe73kJu3Mr98X.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Cartoon Network/Adult Swim)</span></figcaption></figure><h2 id="74-aqua-teen-hunger-force">74. Aqua Teen Hunger Force</h2><p>When Cartoon Network’s Adult Swim programming block premiered in September 2001, <em>Aqua Teen Hunger Force</em> was one of its surreal cornerstones, and it’s pretty much stayed that way ever since. The long-running series follows three anthropomorphic fast food items – Master Shake, Frylock, and Meatwad – who get into all kinds of trouble with their neighbor(s), locals, and interdimensional beings. <em>ATHF</em> helped usher in a new era for adult animation at the turn of the century, and it's remained just as hilarious and timeless during that historic run. But for as wild and nonsensical as it gets, there’s a certain charm that makes it not just one of the funniest shows on Adult Swim, but in all of TV animation. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="aX8ghcRiCenvu9zFLS5neQ" name="" alt="Adventures of Rocky and Bullwinkle and Friends Opening Credit" src="https://cdn.mos.cms.futurecdn.net/aX8ghcRiCenvu9zFLS5neQ.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Jay Ward Productions, Gamma Productions Producers Associates for Television)</span></figcaption></figure><h2 id="73-adventures-of-rocky-and-bullwinkle-and-friends">73. Adventures of Rocky and Bullwinkle and Friends</h2><p>Though not lauded quite as high as animation giants such as Walt Disney or Hanna-Barbera, Jay Ward delivered many of the medium’s most lasting creations, with <em>The Adventures of Rocky and Bullwinkle</em> at the center of his zany, intelligent, and meta-before-meta-was-cool storytelling skills. The titular moose and squirrel’s serialized rivalry with the devious Boris and Natasha can never be forgotten, while the history-adoring side characters Sherman and his pup Mr. Peabody became a pop culture magnet unto themselves over the years. Now if only we could get a Fractured Fairy Tales spinoff for the 21st century…</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="YpWStPZRTBu9kszu7FP44k" name="" alt="Captain Carter in What If...?." src="https://cdn.mos.cms.futurecdn.net/YpWStPZRTBu9kszu7FP44k.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Disney+)</span></figcaption></figure><h2 id="72-what-if">72. What If...?</h2><p>Upon its launch, part of the reason why a <a href="https://www.cinemablend.com/streaming-news/disney-plus-price-plans-and-cost-increases">Disney+ subscription</a> was so appealing involved the streaming service's new content directly connected to major IPs like the Marvel Cinematic Universe. And while we’ve been treated to a number of live-action shows, the studio also took a major risk with the multiversal animated series <em>What If…?</em> The comic book anthology series offers alternate realities to the MCU characters and events we know and love, and shows how the entire franchise could be radically altered if just one character's arc differed. Additionally, the voice cast of <em>What…If?</em> features many Marvel favorites reprising their roles to tell these ambitious stories that could never be produced in live-action.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="GExvyLKLmour6uVYSxK8zJ" name="" alt="Penny Proud awestruck by skateboarders on The Proud Family" src="https://cdn.mos.cms.futurecdn.net/GExvyLKLmour6uVYSxK8zJ.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Disney)</span></figcaption></figure><h2 id="71-the-proud-family-2">71. The Proud Family</h2><p><em>The Proud Family</em> was all about Penny Proud and her wild, yet relatable, journey through high school. While the premise was simple, this show’s fabulous crew of characters is what made it iconic, and its depiction of the day-to-day lives of an African American family is what made it groundbreaking. From our lead Penny to her father Oscar, her besties Dijonay, Zoey, LaCienega and Sticky Webb — and of course Sugar Mama — this family is the best, and we’ll adore them forever.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="uuSLas3FtkqdfbRhX2FH65" name="" alt="Beavis and Butt-head headbanging on the couch" src="https://cdn.mos.cms.futurecdn.net/uuSLas3FtkqdfbRhX2FH65.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Paramount+)</span></figcaption></figure><h2 id="70-beavis-and-butt-head">70. Beavis and Butt-Head</h2><p>Besides <em>The Simpsons</em>, arguably no animated series from the 1990s sparked a bigger array of multi-generational reactions around the country than <em>Beavis and Butthead</em>. As soon as it premiered on MTV in March 1993, Mike Judge’s groundbreaking, edgy, and unsavory cartoon became a national sensation while following two objectively moronic teenagers barely navigating school, life, nachos, and a carousel of music video commentary. Video games, movies, tons of merchandising (both official and bootleg) flooded the market in the years that followed, and there's a reason revivals keep happening: it's a great show, dammit. Mm-heh-heh.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="cFLseLBtQvzJnsVMxMRWY" name="" alt="The bill on Schoolhouse Rock!" src="https://cdn.mos.cms.futurecdn.net/cFLseLBtQvzJnsVMxMRWY.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC)</span></figcaption></figure><h2 id="69-schoolhouse-rock">69. Schoolhouse Rock!</h2><p><em>Schoolhouse Rock!</em> is an animated gem that has been passed down from generation to generation for all the right reasons. Originally debuting on TV back in 1973, the show's approach to combining educational programming with toon-filled songs cemented it as a true classic with more lasting value than most. From grammar-focused tunes like “Conjunction Junction" to the iconic intro-to-governmental-processes track “I’m Just a Bill” to even its Preamble song, <em>Schoolhouse Rock!</em> has had a lasting cultural impact, influencing many other shows, and even inspiring some spoofs along the way to its permanent place within pop culture.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="TTKzyjGCkPz9ENeuXmGjnf" name="" alt="Virgil Hawkins trying on his Static costume for the first time on Static Shock" src="https://cdn.mos.cms.futurecdn.net/TTKzyjGCkPz9ENeuXmGjnf.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Warner Bros./DC)</span></figcaption></figure><h2 id="68-static-shock">68. Static Shock</h2><p>The DC Animated Universe got a true shock to its system when Denys Cowan's <em>Static Shock</em> zapped onto TV screens in the early 2000s as a Saturday morning offering on Kids’ WB. Viewers were treated to some truly exciting, funny and heartfelt episodes that tracked the heroic exploits of teenager Virgil Hawkins in Dakota City. Thanks to late series creator Dwayne McDuffie and his talented team, <em>Static Shock</em> remains a dynamic piece of comic book fun, serving up some serious action mixed in with thoughtful social commentary on occasion. In short, this is a super-powered gem that’s rightfully still revered to this day.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="DBmZDPiRMtaJRDPQ5yvm7V" name="" alt="Dexter and Dee Dee in Dexter's Laboratory" src="https://cdn.mos.cms.futurecdn.net/DBmZDPiRMtaJRDPQ5yvm7V.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Hanna-Barbera Cartoons)</span></figcaption></figure><h2 id="67-dexter-39-s-laboratory">67. Dexter's Laboratory</h2><p>What child hasn't wished they had a secret location in their house that provided the means to do the most fantastic things their heart desires? <em>Dexter’s Laboratory</em> helped many youngins live vicariously through its titular brainiac, and the general hilarity of his meddling sister Dee Dee derailing it all helped make this one a definitive Cartoon Network classic. From the brain of the similarly brainy Genndy Tartakovsky, <em>Dexter</em> also boasted other animated shorts like <em>Dial M For Monkey</em> and <em>The Justice Friends</em>, which were all equally as enjoyable. To this day, I bet there are many who owe their ability to say “cheese omelet” in French to this wonderful series. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="Muqkb45hSgoWEcxcehYAE" name="" alt="Kim Possible and Ron Stoppable in promo shot" src="https://cdn.mos.cms.futurecdn.net/Muqkb45hSgoWEcxcehYAE.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Disney Channel)</span></figcaption></figure><h2 id="66-kim-possible">66. Kim Possible</h2><p>“Call me, beep me, if you want to reach me,” because it’s time to <a href="https://www.cinemablend.com/television/kim-possible-things-about-the-disney-channel-show-that-i-still-think-about"><u>talk about </u><u><em>Kim Possible</em></u></a>. Mixing a high-stakes spy drama with high school shenanigans appropriate for Disney Channel-aged audiences, this show is an action-packed good time. Largely centered on Kim’s missions to take down Dr. Drakken and Shego with the help (or more like attempted help) of her bestie Ron Stoppable and his naked molerat Rufus, <em>Kim Possible</em> defined many childhoods and taught generations of kids, and specifically girls, that anything is possible with the right mindset and gadgets. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="THCXDXeWUifPpfjKx8x7tJ" name="" alt="Muppet character group shot from Muppet Babies intro" src="https://cdn.mos.cms.futurecdn.net/THCXDXeWUifPpfjKx8x7tJ.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: YouTube)</span></figcaption></figure><h2 id="65-muppet-babies-1984">65. Muppet Babies (1984)</h2><p>How amazing are Jim Henson’s Muppets? The list goes on, but one key factor would be that Kermit and the gang brought to life what remains one of pop culture’s only genuinely great examples of “Your favorite characters, but they’re babies.” Trading TV studios and New York City exteriors for a Nanny-run nursery where the power of make-believe knows no bounds, <em>Muppet Babies</em> showed viewers of all ages that imagination is powered best when one is surrounded by friends to the end. Unfortunately for avid fans, the show’s abundant use of licensed TV, film, and music clips will likely keep it from ever hitting home media.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="FSU7vPytZsb6uY9uEH3R7b" name="" alt="the griffin family on family guy" src="https://cdn.mos.cms.futurecdn.net/FSU7vPytZsb6uY9uEH3R7b.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Fox)</span></figcaption></figure><h2 id="64-family-guy">64. Family Guy</h2><p>For one reason or 69 others — get it, Peter? — certain TV shows are able to get away with wildly edgy content <a href="https://www.cinemablend.com/television/2470743/why-family-guy-is-protected-from-public-outrage-against-offensive-jokes-according-to-seth-macfarlane"><u>without getting “canceled,"</u></a> either literally or figuratively. Granted, Seth MacFarlane's long-running fave <em>Family Guy</em> actually <em>did</em> actually get canceled by Fox back in 2002, but the '80s-adoring comedy was able to return from its shallow grave just two years later due to extraordinary DVD sales, a hit syndicated run, and the embrace of Adult Swim.  and high ratings from reruns in syndication. Ever since that 2004 revival, viewers have followed the antics of Peter, Lois, Chris, Meg, Stewie and Brian along with all the ridiculous and often offensive cutaway flashbacks that fill their lives.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="cUU9RXK47a6nVcxXV84W2b" name="" alt="Robot Chicken Intro Screenshot" src="https://cdn.mos.cms.futurecdn.net/cUU9RXK47a6nVcxXV84W2b.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Sony)</span></figcaption></figure><h2 id="63-robot-chicken">63. Robot Chicken </h2><p>Watching <em>Robot Chicken</em> calls to mind many chldhood memories of inventing scenarios with action figures modeled after classic movie and TV characters. That's essentially what Seth Green and Matthew Senreich’s stop-motion animated Adult Swim hit is: people playing with their toys. But with a bigger budget and more talented voice actors than any kids I ever played with. With boundary-pushing and  insightful humor in the mix, the Emmy-winning <em>Robot Chicken</em> is sketch comedy at its most refreshingly unique, rebelliously raw, and deliciously nostalgic, and is not bogged down by the limitations that might come with a live-action production.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="vDPGsqpz2aexUpePxhSrFj" name="" alt="The Flintstones in their fly mobile" src="https://cdn.mos.cms.futurecdn.net/vDPGsqpz2aexUpePxhSrFj.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Hanna-Barbera Productions)</span></figcaption></figure><h2 id="62-the-flintstones">62. The Flintstones</h2><p>For many people, <em>The Flintstones</em> is one of the first cartoons we remember watching on TV. This classic Hanna-Barbera series about a lovable caveman and his family navigating a prehistoric world field with outrageous stone-age variations of modern-day appliances and tools, is just as funny and attention-grabbing as it was upon its release more than 60 years ago, which is really saying something about its quality. On top of such indelible characters like Fred Flinstone, Barney Rubble, and the Great Gazoo, the show also has one of the most iconic opening themes of all time.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="zMfbgK5BWq6JwG6eTqKZ6F" name="" alt="Paul Rugg on Freakazoid!" src="https://cdn.mos.cms.futurecdn.net/zMfbgK5BWq6JwG6eTqKZ6F.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Warner Bros.)</span></figcaption></figure><h2 id="61-freakazoid">61. Freakazoid!</h2><p>Though not the most marquee-ready superhero, <em>Freakazoid!</em>’s titular protagonist is the creation of <em>Batman: The Animated Series</em> legends Bruce Timm and Paul Dini, with Steven Spielberg and <em>Tiny Toons</em> vet Paul Ruegger leading the charge. So yeah, it’s a perfectly bonkers mix of comic book mythos mixed with slapstick and fourth-wall-breaking comedy, complete with a mini-universe of B-tier heroes and villains such as Candle Jack (but don’t say his name). Lasting two seasons from 1995-1997, <em>Freakazoid!</em> ss a joy for viewers of all ages, anchored by the stellar voice work of stars Paul Rugg and Ed Asner.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="BcYw5d2QyyTS2aEMbG98jJ" name="" alt="Chip n' Dale: Rescue Rangers Intro Screenshot" src="https://cdn.mos.cms.futurecdn.net/BcYw5d2QyyTS2aEMbG98jJ.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Disney)</span></figcaption></figure><h2 id="60-chip-39-n-39-dale-rescue-rangers">60. Chip 'n' Dale: Rescue Rangers</h2><p>Long before the series was reimagined as a <a href="https://www.cinemablend.com/movies/disneys-chip-n-dale-rescue-rangers-review-a-disney-classic-is-reborn-as-a-fast-and-funny-crime-caper">hilarious Disney+ movie</a> starring John Mulaney and Andy Sandberg, <em>Chip 'n' Dale: Rescue Rangers</em> started out as a tremendous and timeless action-adventure toon about a pair of chipmunks fronting a crew of anthropomorphic animals. Thanks in part to that earworm theme, it never gets old watching Chip, Dale, Gadget Hackwrench, Monterey Jack, and Zipper solve all manner of crimes (both big and small, really small) and save the day before the end of each episode, and the show can still hold the attention of our kids all these years later.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="7TPzMzFJzAc7Z2DMQqKELc" name="" alt="The Titans on Teen Titans" src="https://cdn.mos.cms.futurecdn.net/7TPzMzFJzAc7Z2DMQqKELc.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Warner Bros. Animation)</span></figcaption></figure><h2 id="59-teen-titans">59. Teen Titans</h2><p>Some viewers probably weren’t sure what to make of <em>Teen Titans</em> upon its debut, but the series eventually became a hit – and for good reason. The quirky superhero romp is the definition of cartoon greatness, as it skillfully blends action and comedy, ultimately using both to great effect. Yet, most importantly, so much heart is on display amidst the explosions and sheer wackiness as well. Because of that, Robin, Cyborg, Starfire, Beast Boy and Raven remain not only one of DC’s best TV super teams, but also one of its greatest familial units. And, yes, that theme song still slaps.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="uExdQjeQwMyQUfVedd2gNH" name="" alt="Goliath facing off against Demona on Gargoyles" src="https://cdn.mos.cms.futurecdn.net/uExdQjeQwMyQUfVedd2gNH.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Disney)</span></figcaption></figure><h2 id="58-gargoyles">58. Gargoyles</h2><p>The <a href="https://www.cinemablend.com/television/massively-underrated-90s-animated-tv-shows">oft-underrated Saturday morning toon</a> <em>Gargoyles</em> is one of those shows that manages to deliver more than the kind of action you’d expect from Disney's weekly animated fare. It’s a dark and complex drama series with dynamic characters, beautiful animation and stories that sometimes border on Greek tragedy. Many viewers understandably still have such reverence for the tales that EP Greg Weisman and his team told about the mighty Goliath and his clan of night guardians. It’s ironic that a group of beings that turn cold as stone are among some of the warmest heroes to ever grace a TV screen.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="8syYMg2XtkKbrxSTPuip4K" name="" alt="Scrooge McDuck with Huey, Dewey and Louie" src="https://cdn.mos.cms.futurecdn.net/8syYMg2XtkKbrxSTPuip4K.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Disney Animation)</span></figcaption></figure><h2 id="57-ducktales">57. DuckTales</h2><p>Having quite possibly the <a href="https://www.cinemablend.com/television/1600890/epically-awesome-new-ducktales-cast-sings-the-theme-song-and-we-are-so-ready-for-this"><u>catchiest theme song</u></a> on this list that's chock-full of them is probably enough reason to include <em>DuckTales</em> on this list, but of course, the show has so much more going for it. Scrooge McDuck and his nephews, previously only bit players in Disney cartoons, earned the star spotlight for a show that was about as close to an action/adventure cartoon as Disney had delivered at the time, making it something fresh new, and exciting. But it was still “Disney” and thus more accessible to younger viewers than other ‘80s cartoons looking to sell action figures, drawing from Carl Banks' timeless comic run.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="PJZPBtky9Qc5mzTEs8YzNP" name="" alt="Arnold and Gerald for Hey Arnold!" src="https://cdn.mos.cms.futurecdn.net/PJZPBtky9Qc5mzTEs8YzNP.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Nickelodeon)</span></figcaption></figure><h2 id="56-hey-arnold">56. Hey Arnold!</h2><p>Amidst all of Nickelodeon's best chracters, perhaps no greater role model for younger viewers exists than the football-headed protagonist of <em>Hey Arnold!</em> In fact, Craig Bartlett’s series offered something very few animated programs have (then or since): a diverse ensemble whom kids could potentially relate to or aspire to be like. With a stunningly grounded urban aesthetic, even in its most peculiar momens, and a hefty set of valuable life lessons that <a href="https://www.cinemablend.com/television/1653579/8-nickelodeon-shows-that-are-way-darker-than-they-should-have-been"><u>often came out of dark situations</u></a>, admittedly — not to mention an absolute banger of a jazz score — <em>Hey Arnold!</em> is a masterstroke for the medium.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="XxJqVbNP9vPSgZ5FAQJGyK" name="" alt="The team on The Real Ghostbusters" src="https://cdn.mos.cms.futurecdn.net/XxJqVbNP9vPSgZ5FAQJGyK.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: DIC Enterprises)</span></figcaption></figure><h2 id="55-the-real-ghostbusters">55. The Real Ghostbusters</h2><p>1984's <em>Ghostbusters</em> inspired an immediate sequel, but when live-action follow-ups stalled, Sony did the next best thing: created this magnificent riff on the beloved property. No, they couldn’t get BIll Murray and Dan Aykroyd together every three years, but they could animate Peter, Ray, Winston and Egon for a series of animated adventures around New York City, the world, and even realms beyond. The best part about <em>The Real Ghostbusters</em> is that it understood the irreverent tone of Ivan Reitman’s two movies, but split the difference to also appeal directly to kids who just wanted to see Slimer. When we really need a hit of that nostalgic rush, these are the <em>Ghostbusters</em> stories that most deserve revisiting.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="izYZtYqP6g3QmTTQLe3k5g" name="" alt="Teen Titans Go!'s versions of Beast Boy, Starfire, Robin, Raven and Cyborg" src="https://cdn.mos.cms.futurecdn.net/izYZtYqP6g3QmTTQLe3k5g.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Warner Bros. Animation)</span></figcaption></figure><h2 id="54-teen-titans-go">54. Teen Titans Go</h2><p>DC Comics adaptations often get knocked for being too serious, but that's not the case with <em>Teen Titans Go</em>, an effervescent, energetic, and rapid-fire funny series centered on Robin, Cyborg, Beast Boy, Raven, and Starfire. The show embraced irreverent humor, leaning hard into its heroes' stereotypical behaviors, from Robin’s crippling need to be a leader to Raven’s broody Goth Girl energy and beyond. Without hinging on continuity or major cameos from A-list DC heroes (at least, not until <a href="https://www.cinemablend.com/reviews/2454600/teen-titans-go-to-the-movies-review"><em>Teen Titans Go! To The Movies</em></a>, which was equally excellent), this slap-happy toon basically gave young kids a comic book portal where they could enjoy “waffles, waffles, waffles” without having to brood over anyone's parents getting gunned down in an alley.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="NvTqNnRZB6ZRapspFDNrrg" name="" alt="The Powerpuff Girls in action" src="https://cdn.mos.cms.futurecdn.net/NvTqNnRZB6ZRapspFDNrrg.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Hanna-Barbera Cartoons)</span></figcaption></figure><h2 id="53-the-powerpuff-girls">53. The Powerpuff Girls</h2><p>Sugar, spice, and everything nice wasn’t even half of what we got with <em>The Powerpuff Girls</em>. Like many other animated classics, it was a show made for kids that adults could easily also enjoy. The superpowered Blossom, Bubbles and Buttercup deal with typical childhood troubles like sibling rivalry and bed wetting while also saving their town from a truly ingenious rogue’s gallery. These endearing kindergartners, their friends and foes (like arch nemesis Mojo Jojo, and Powerpuff wanna-be Princess Morbucks) provide us with laughs, lessons and intrigue, all wrapped in a parody and pop-culture focused package that doles out plenty of surprises.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.33%;"><img id="QNPtreSvJsWu3NJLAE43Zm" name="" alt="Tiny Toon Adventures opening" src="https://cdn.mos.cms.futurecdn.net/QNPtreSvJsWu3NJLAE43Zm.jpg" mos="" align="middle" fullscreen="" width="1280" height="721" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: WB)</span></figcaption></figure><h2 id="52-tiny-toon-adventures">52. Tiny Toon Adventures</h2><p>Following in the footsteps of the iconic <em>Looney Tunes</em> squad was always going to be a tall order, but the Stephen Spielbeg-produced <em>Tiny Toon Adventures</em> understood the assignment. While the characters may have been inspired by those that came before, each one from Babs and Buster to Plucky and Hampton, was given just as much freedom to be entirely new characters, not simply the “new versions” of the classics. The humor was always on point, with plenty of gags for younger viewers, alongside references only the older “kids” watching would get.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="wCHNuCfviaUhRcx2h9iPTg" name="" alt="Murial and Courage in Courage the Cowardly Dog." src="https://cdn.mos.cms.futurecdn.net/wCHNuCfviaUhRcx2h9iPTg.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Cartoon Network)</span></figcaption></figure><h2 id="51-courage-the-cowardly-dog">51. Courage the Cowardly Dog</h2><p>Making a cartoon for children that's as creepy as it is funny is no easy task, but <em>Courage the Cowardly Dog</em> found a way to execute that balance quite beautifully, relying mostly on overtly bizarre and/or paranormal villains. Courage protecting his owners, Eustace and Muriel, against everything from a cursed mummy to a duck with a mallet never gets old. It’s the most deserving <a href="https://www.cinemablend.com/television/2479572/6-cartoon-network-shows-that-deserve-a-revival"><u>Cartoon Network original that needs a revival</u></a>, which could potentially still happen someday, considering <em>Courage</em> was part of a <em>Scooby-Doo</em> crossover movie released in 2021. Until that day comes, fans can revisit the entire series with a <a href="https://www.cinemablend.com/television/2570432/subscribing-to-hbo-max-what-to-know-about-the-price-options-and-what-the-streaming-service-offers"><u>Max subscription</u></a>. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="Rbt6qRMYMeBZzRz4sH6k4i" name="" alt="Finn and Jake from Adventure Time" src="https://cdn.mos.cms.futurecdn.net/Rbt6qRMYMeBZzRz4sH6k4i.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Cartoon Network)</span></figcaption></figure><h2 id="50-adventure-time">50. Adventure Time</h2><p>Most classic adventure cartoons engage in storytelling in a more earnest manner, but only a few effectively capture the joys of make-believe like <em>Adventure Time</em> — which for many is the absolute cream of the crop for Cartoon Network’s original programming. Creator Pendleton Ward’s fantasy-comedy follows Finn the Human (Jeremy Shada) and Jake the Dog (John DiMaggio) as they navigate the weird and wonderful, post-apocalyptic Land of Ooo, having a mathematical time along the way. With its charming animation, ingenious creatures, clever world-building, and a lighthearted tone that never abandons spellbinding excitement, the fun truly never ends.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="wbb3BnJE3tDyHGjZEcvuG5" name="" alt="Gina Rodriguez on Big Mouth" src="https://cdn.mos.cms.futurecdn.net/wbb3BnJE3tDyHGjZEcvuG5.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="49-big-mouth">49. Big Mouth</h2><p>It’s not every day that audiences get a <a href="https://www.cinemablend.com/television/1707839/big-mouth-review-netflixs-coming-of-age-cartoon-is-hilariously-crude-yet-shockingly-earnest"><u>hilariously offensive animated show</u></a> that actually provides <a href="https://www.cinemablend.com/television/how-big-mouth-gets-lgbtq-representation-right"><u>accurate representation of growing up LGBTQ+</u></a>. On the surface, Netflix's <em>Big Mouth</em>, which rocks an all-star cast led by co-creator Nick Kroll and John Mulaney, simply shows the trouble and turmoil of puberty, sexuality, hormones, and the everyday struggle that we call “life.” Lucky for viewers, it is also much, much more than that. The show follows a group of young people who tend to be accompanied by “hormone monsters” (who now have their own <a href="https://www.cinemablend.com/television/2569936/human-resources-quick-things-we-know-about-the-big-mouth-spinoff-coming-to-netflix"><u>wacky spinoff series</u></a>) who help guide them through the changes and struggles that come with growing up. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="7SmL7Vdvc8GYHMysMikJP5" name="" alt="Arthur" src="https://cdn.mos.cms.futurecdn.net/7SmL7Vdvc8GYHMysMikJP5.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: PBS)</span></figcaption></figure><h2 id="48-arthur">48. Arthur</h2><p>Kids owe PBS for so many great animated series, but <em>Arthur</em> might be its crown jewel. For over 20 years, Marc Brown’s storybook aardvark, along with his friends and family, endeared themselves to the public. The author and the show’s writing staff, through their efforts, taught youngsters firm lessons in responsibility, community, empathy and much more. What’s particularly impressive is that the grade-school comedy managed to remain consistent in conveying such morals during its lengthy run. Of course, when the program wasn’t dropping vital nuggets of knowledge, it was simply exuding pure, imaginative fun. What we have here is a truly timeless show, and one that’s sure to delight audiences for generations to come.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="27GcMDghgy4THmua9gzW2T" name="" alt="Misty and Brock, friends of Ash's in Pokemon." src="https://cdn.mos.cms.futurecdn.net/27GcMDghgy4THmua9gzW2T.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: The Pokemon Company)</span></figcaption></figure><h2 id="47-pokemon">47. Pokémon</h2><p>Part of the reason <em>Pokémon</em> remains one of the top franchises worldwide is because the series can have a different meaning for every generation that consumes it. The kids of 2024 can watch the same show O.G. viewers watched in the late '90s and appreciate those characters in new ways, given there have been plenty of successive projects that have come loaded with over a thousand different Pokémon for children to latch onto and make their favorite. The show's awesome battles haven't quite held up when it comes to the franchise's many video games, but perhaps someday, Game Freak will give the people what they want. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="NXWgTk3QbeJWN8Xzqgyz8X" name="" alt="Venom and Spider-Man in Spider-Man: The Animated Series" src="https://cdn.mos.cms.futurecdn.net/NXWgTk3QbeJWN8Xzqgyz8X.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Marvel)</span></figcaption></figure><h2 id="46-spider-man">46. Spider-Man</h2><p>Spider-Man fandom has been known to grow from many sources, including the comics and multiple generations of live-action blockbusters, but the <em>Spider-Man</em> animated series from 1994 holds a special place in the hearts of millennials – as it should, because it is amazing (pun totally intended). In retrospect, the content censorship is ridiculous (this is a show where Spidey wasn’t even allowed to punch people), but the filmmakers still found ways to deliver exciting adaptations of comic book stories, and some episodes are even better than the source material. We have yet to see a better version of the Venom origin story than what was created here.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="9jG5B3P7AAv2BtKAmpGykW" name="" alt="Diedrich Bader's Batman in Batman: The Brave and the Bold" src="https://cdn.mos.cms.futurecdn.net/9jG5B3P7AAv2BtKAmpGykW.jpeg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Warner Bros. Animation)</span></figcaption></figure><h2 id="45-batman-the-brave-and-the-bold">45. Batman: The Brave and the Bold</h2><p>Thanks in large part to the success of Tim Burton’s <em>Batman</em> from 1989, it was at one point decided that the best version of the Caped Crusader is the dark and brooding version. That has now been the go-to mode for the superhero for decades – but at the very least <em>Batman: The Brave And The Bold</em> reminded us for a time just how much fun the Dark Knight can be. The deep voice and silly sensibilities of Diedrich Bader make him one of the best to ever play the hero, and every episode delivers a fun team-up opportunity. Every DC character is represented with love, but there’s an argument to be made that John DiMaggio's Aquaman is the all-time best version of the Atlantean king.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="zWeMecUYuL5wvappyqQt2f" name="" alt="Doug Funnie" src="https://cdn.mos.cms.futurecdn.net/zWeMecUYuL5wvappyqQt2f.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Nicktoons)</span></figcaption></figure><h2 id="44-doug">44. Doug</h2><p><a href="https://www.cinemablend.com/television/1705680/10-classic-nicktoons-ranked-by-pure-weirdness"><u>The entire Nicktoons library</u></a> was a big deal for '90s kids, and who was more relatable than Doug Funnie on <em>Doug</em>? Through his journal entries and soaring imagination, the preteen opened up about the seemingly everyday events of his life, from getting a haircut to trying liver and onions, and we totally felt that. We understood the middle school awkwardness, the anguish of his crush on Patti Mayonnaise and just how good it felt to rock out to your favorite band (The Beets, of course! “Aw-wee-oo! Killer tofuuuuu!”). We wanted Skeeter to be our best friend and a dog as cool as Porkchop. Not to mention, the opening credits and theme song are pretty iconic.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="Dbk4mqeBbvWTvLLHZqxEEh" name="" alt="Pinky and the Brain smashed together in Animaniacs Season 2" src="https://cdn.mos.cms.futurecdn.net/Dbk4mqeBbvWTvLLHZqxEEh.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Hulu)</span></figcaption></figure><h2 id="43-pinky-and-the-brain">43. Pinky and the Brain</h2><p>Let’s be honest here: <em>Pinky and the Brain</em> was repetitive. In every episode, the two main characters did “the same thing we do every night, Pinky… try to take over the world!” But it was the way that the odd couple mice played off of each other — with Pinky being the doofus assistant to the Orson Welles-inspired mastermind mouse that is The Brain — that allowed this <em>Animaniacs</em> episode segment to thrive as its own standalone series. It's one we still quote to this day, using many of the cast members’ favorite jokes. Like everything in <em>Animaniacs</em>, <em>Pinky and the Brain</em> benefitted from an “anything goes” approach to humor, meaning that stories would involve Brain’s archnemesis (a hamster named Snowball) or a bit where Pinky gets elected President of the United States. And it all worked because the creators understood how to be intelligent while also being goofy.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="ZCVbZWH64KMBTvZ7HZwHDM" name="" alt="X-Men: The Animated Series promotional artwork of Wolverine, Gambit and Rogue" src="https://cdn.mos.cms.futurecdn.net/ZCVbZWH64KMBTvZ7HZwHDM.jpeg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Marvel)</span></figcaption></figure><h2 id="42-x-men-the-animated-series">42. X-Men: The Animated Series</h2><p>Before the Marvel Cinematic Universe revitalized how big and connected comic book adaptations could be, few film and TV examples truly brought to live what people loved about the medium. <em>X-Men: The Animated Series</em> was one of the first, giving audiences comic book-accurate versions of the beloved mutants that felt like they jumped right off the page. The show offered long-term serializing storytelling just like the source material, something that was essentially unheard of for a Saturday morning cartoon. But whether one was an avid reader or not, these were (and perhaps still are) the definitive versions of the X-Men. It’s no wonder that decades later, the series was <a href="https://www.cinemablend.com/superheroes/x-men/x-men-97-trailer-beloved-cartoon-theme-song-still-slaps"><u>revived as </u></a><a href="https://www.cinemablend.com/superheroes/x-men/x-men-97-trailer-beloved-cartoon-theme-song-still-slaps"><u><em>X-Men '97</em></u></a>.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="95FkJheQrs96ku5avb5WnH" name="" alt="Tulip Olsen in Infinity Train" src="https://cdn.mos.cms.futurecdn.net/95FkJheQrs96ku5avb5WnH.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Cartoon Network Studios)</span></figcaption></figure><h2 id="41-infinity-train">41. Infinity Train</h2><p>Created by <em>Regular Show</em> writer/artist Owen Dennis, the Cartoon Network-turned-Max series <em>Infinity Train</em> is the crown jewel of overlooked and under-discussed animated series. A highly imaginative coming-of-age sci-fi fantasy,  not the most common sub-genre, the series centers on a different interconnected story and character set in each of its four seasons, with everything taking place on a mysterious and impossibly long train where most cars present challenges for the characters to figure out and overcome. It’s an emotionally gripping and exciting tale that never goes off the rails, with a stacked cast of familiar voices.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="cgRABtfyLLGDW5oD7tDSxA" name="" alt="Bender holds Fry and Leela close to himself in Futurama." src="https://cdn.mos.cms.futurecdn.net/cgRABtfyLLGDW5oD7tDSxA.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Hulu)</span></figcaption></figure><h2 id="40-futurama">40. Futurama</h2><p>The second mega-hit series created in part by Matt Groening, <em>Futurama</em> has always been far more than just <em>The Future Simpsons</em>, thanks to its unforgettable cast of meme-ready nutjobs, egomaniacs, and bending-proficient robots. From Fry’s dopey optimism to The Professor’s absent-minded genius to Hermes’ ability to drop everything if a limbo stick comes around, the series balances its strong personalities with tons of space-faring, paradox-thwarting, time-traveling mayhem that never stops being fun. Both one of the smartest and silliest animated series of all time, and filled with some of the nerdiest jokes possible, <em>Futurama</em> has remained a beloved small-screen entity in part because the Planet Express crew has managed to survive multiple cancellations at Fox and Comedy Central, reaching its third lifeform at Hulu, presumably because the Hypnotoad demanded it so.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="VvAnfGk8Ku2L8XbMxAXwtS" name="" alt="Mickey Mouse classic animated short "The Band Concert" from 1935." src="https://cdn.mos.cms.futurecdn.net/VvAnfGk8Ku2L8XbMxAXwtS.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Disney)</span></figcaption></figure><h2 id="39-mickey-mouse-classic-disney-shorts">39. Mickey Mouse (Classic Disney Shorts)</h2><p>There are few animated characters more famous than Mickey Mouse, and it’s safe to say the House of Mouse wouldn’t be everything it is today without Disney’s classic <em>Mickey Mouse</em> animated shorts that debuted in the 1920s. Smartly written and brimming with slapstick comedy, these quick hits of quirky fun introduced us to the loveable mouse — who displayed courage and strength but in a way that was achievable for any of us — along with the equally iconic Minnie Mouse, Donald Duck, Daisy Duck, Pluto and Goofy. Included in this series is 1935’s “The Band Concert” — Disney’s first color cartoon, which quite literally paved the way for <a href="https://www.cinemablend.com/movies/disney-at-100-the-best-movie-from-each-of-the-companys-first-10-decades"><u>Disney animation for 100 years</u></a> and counting. And while it may not be part of that exact era, give me Goofy bungling up ski lessons any day.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="t9xtMju7CHFDFSw3uBYz26" name="" alt="Goku and the crew" src="https://cdn.mos.cms.futurecdn.net/t9xtMju7CHFDFSw3uBYz26.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Funimation)</span></figcaption></figure><h2 id="38-dragon-ball-z">38. Dragon Ball Z</h2><p>Though it wasn’t the first show in the franchise, <em>Dragon Ball Z</em> introduced countless kids and teenagers to iconic characters like Goku, Piccolo, Vegeta, and Gohan throughout the ‘90s, especially after the anime series became a mainstay in Cartoon Network’s Toonami afternoon block. This intense cartoon about a group known as the Z Fighters who attempt to protect Earth (and later, other planets) from diabolical forces was something many of us ran home from school or off the bus to catch each weekday. The introduction of increasingly dangerous and destructive villains like Frieza, Cell, and Boo (each had their own saga) continued to raise the bar as the series went on, and make this still a gem worth revisiting.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="szHGNT2jeHisjnVqiJPKkS" name="" alt="The characters on Rocko's Modern Life" src="https://cdn.mos.cms.futurecdn.net/szHGNT2jeHisjnVqiJPKkS.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Nickelodeon)</span></figcaption></figure><h2 id="37-rocko-39-s-modern-life">37. Rocko's Modern Life</h2><p>Is there a <a href="https://www.cinemablend.com/television/the-top-12-nickelodeon-tv-shows-of-the-90s">classic Nickelodeon show from the ‘90s</a> that captures the spirit of the era more than <em>Rocko’s Modern Life</em>? This zany, surreal, and extraordinary animated series debuted in 1993 and quickly found an audience thanks to its unique style of humor that appealed to both children and adults. With characters like the neurotic titular wallaby, his best friends Heffer Wolfe and Filburt, and the various members of the Bighead family, there was so much to love about the show. It pushed the envelope with its humor and art direction and had a lot to say about the modern world, hence its name. The mammalian gang even returned to fans in 2019 with the special <em>Static Cling</em>.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="qbYe8yRQxhJLiRfEF3Mm4M" name="" alt="The Warner siblings on Animaniacs" src="https://cdn.mos.cms.futurecdn.net/qbYe8yRQxhJLiRfEF3Mm4M.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Hulu)</span></figcaption></figure><h2 id="36-animaniacs">36. Animaniacs</h2><p>We still have no idea how <em>Animaniacs</em> creator Tom Ruegger got the greenlight to make everyone's childhood better with this hilarious, clever, but extremely inside-baseball showbiz comedy aimed at mature kids. Yes, on the surface, the <em>Animaniacs</em> works as a variety show, an evolution off <em>The Muppet Show</em> during which the hosts – the Warner siblings, one with a Liverpool accent – would set up individual cartoons. But in between, the banter and humor offered up in <em>Animaniacs</em> consisted of some of the funniest, most outrageous, and unpredictable jokes that would spoof Dolly Parton, Marilyn Monroe, and the idea of fingering Prince, as it were. Sometimes the show managed to be educational, but mostly it was pure lunacy, and we loved every second of it. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="ZawUr9b8AhMBLhaw5EbHmK" name="" alt="Scooby-Doo on Scooby-Doo, Where Are You" src="https://cdn.mos.cms.futurecdn.net/ZawUr9b8AhMBLhaw5EbHmK.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Hanna-Barbera)</span></figcaption></figure><h2 id="35-scooby-doo-where-are-you">35. Scooby-Doo, Where Are You!</h2><p>Mysteries are the most entertaining genre of storytelling. What’s more satisfying than a tidy reveal at the end of a whodunit, and a villain exclaiming how they would have gotten away with it, if not for those meddling kids? <em>Scooby-Doo, Where Are You?</em> followed a very popular “monster of the week” format, but wasn’t afraid to push the envelope to freak out little kids who tuned into a cartoon and were terrified by haunted suits of armor, killer clowns, and more. From its unforgettable theme song to the vocal contributions of radio icon Casey Kasem as Shaggy, <em>Scooby-Doo Where Are You?</em> walked so that <em>Goosebumps</em> and <em>Gravity Falls</em> could run.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="2PFzVPzEaoPb4AxVMtwhyb" name="" alt="Scooby and the gang on Scooby-Doo: Mystery Incorporated" src="https://cdn.mos.cms.futurecdn.net/2PFzVPzEaoPb4AxVMtwhyb.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Warner Bros. Animation)</span></figcaption></figure><h2 id="34-scooby-doo-mystery-incorporated">34. Scooby-Doo! Mystery Incorporated</h2><p><em>Scooby-Doo: Mystery Incorporated</em> is a breath of fresh air within the long-running franchise birthed by Hanna-Barbera. For this particular production, the typical case-of-the-week format isn’t in play, as serialized storytelling is utilized. It’s a great approach that really fleshes out the meddling kids and the titular canine in a way that past incarnations don’t. The humor associated with this entertainment property is definitely employed in this iteration. However, what’s also exciting is how the writers and artists aim to deliver some truly scary monsters, all seemingly tied to the antagonist Mr. E. While it’s admirable that the show sticks to its predecessors’ roots in many ways, its goal to shake up the classic formula results in an overarching mystery that’s both compelling and creepy.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="a4AgkmxdoeeKnTXVKhiqVT" name="" alt="Archer and Lana on motorcycle in Archer" src="https://cdn.mos.cms.futurecdn.net/a4AgkmxdoeeKnTXVKhiqVT.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: FX)</span></figcaption></figure><h2 id="33-archer">33. Archer</h2><p>Creator Adam Reed’s singular vision and undying creativity turned <em>Archer</em> from a ribald spin on James Bond into one of the most well-rounded pieces of spy fiction in existence. H. Jon Benjamin’s unmistakable voice gives life to the booze-swilling agent’s snappy insults and TV-MA euphemisms alongside a downright stellar cast that also includes Aisha Tyler, Judy Greer, Jessica Walter, Chris Parnell and more. The series is a testament to the importance of characters compared to plot, with <em>Archer</em>’s core group shifting from years of traditional storytelling to multiple side-mission seasons such as the Miami-set <em>Vice</em>, the subconscious-set <em>Dreamland</em>, the jungle-filled <em>Danger Island</em> and others. On a jokes-per-minute basis, it stands next to comedy giants like <em>The Simpsons</em> and <em>Airplane!</em>, and can drink them both under the table.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="rqfLPp6gfonHE794wGnnSX" name="" alt="Terry McGinnis facing down Joker in Batman Beyond: Return of The Joker" src="https://cdn.mos.cms.futurecdn.net/rqfLPp6gfonHE794wGnnSX.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Warner Bros. Animation)</span></figcaption></figure><h2 id="32-batman-beyond">32. Batman Beyond</h2><p>Debuting in 1999, <em>Batman Beyond </em>jumps decades forward into the future and showcases the story of a now-retired Bruce Wayne who is acting as a mentor to the next generation Dark Knight, Terry McGinnis, as voiced by the legend himself, Kevin Conroy. The show earned multiple award nominations, winning two Daytime Emmy Awards. Bruce and Terry have just enough similarities and frustrating differences to keep their dynamic captivating while still wholesome, which makes this particular animated series <a href="https://www.cinemablend.com/television/2477875/why-batman-beyond-is-one-of-the-best-iterations-of-batman"><u>one of the most enjoyable to watch in the franchise</u></a>. Terry is forced to work twice as hard in order to balance out both his personal life and his crime-fighting side persona, as he both learns from and teaches his mentor as they both work to stand up for what they both clearly believe in. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="jAySnDWQdUjDMETg72gnYf" name="" alt="Star Wars: The Clone Wars Season 7 promo image depicting many characters" src="https://cdn.mos.cms.futurecdn.net/jAySnDWQdUjDMETg72gnYf.jpeg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Lucasfilm)</span></figcaption></figure><h2 id="31-star-wars-the-clone-wars">31. Star Wars: The Clone Wars</h2><p>While a lot is owed to Genndy Tartakovsky’s <em>Star Wars: Clone Wars</em>, the animated side of George Lucas’ sci-fi universe truly took off in 2008 with the launch of Cartoon Network's <em>Star Wars: The Clone Wars</em>. The series is, in large part, what it is due to franchise guru Dave Filoni, who thought his hiring was a prank. Filoni’s respect for Lucas’ work permeates the entire CGI show, but there are also some cool elements that he himself adds to the canon, including the now-beloved Jedi Ahsoka Tano. With incredible storylines, sweet animation and strong voice acting, this show works well on its own but also stands firmly alongside the films it builds upon.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="b3iUHMxibSZdrESfdwtAKR" name="" alt="An image from 20th Century Studios' The Bob's Burgers Movie" src="https://cdn.mos.cms.futurecdn.net/b3iUHMxibSZdrESfdwtAKR.jpeg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: 20th Century Studios)</span></figcaption></figure><h2 id="30-bob-39-s-burgers">30. Bob's Burgers</h2><p>One of the many things to love about <em>Bob’s Burgers</em> is just how close, loving, and, well, lovingly strange the main characters at the center of the show are. The Belcher family is (mostly) committed to keeping their small, family-run burger shop up and running, but their kooky adventures usually take the whole family away from the restaurant. Exasperated pessimist Bob, his happy-go-lucky wife Linda and their kids, Tina, Gene and Louise get into a number of hilariously weird scrapes that, honestly, most of us only wish we could have to make life more intriguing. Add to that Louise’s near-constant scheming, Tina’s awkwardness, and how the whole family interacts with a town full of endearing oddballs, and you have yourself a wonderfully weird winner. Tell 'em Teddy sent ya.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="pYN6DPZE8TzwMBsFRU6i4c" name="" alt="The Teenage Mutant Ninja Turtles animated series cast" src="https://cdn.mos.cms.futurecdn.net/pYN6DPZE8TzwMBsFRU6i4c.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Group W Productions)</span></figcaption></figure><h2 id="29-teenage-mutant-ninja-turtles-1987">29. Teenage Mutant Ninja Turtles (1987)</h2><p><em>Teenage Mutant Ninja Turtles</em> was the perfect show for a perfect moment in time. It combined outrageous and over the top late 80s imagery with some of the first mainstream depictions of skater culture and added ninjas, an outrageous backstory and a steady stream of cheesy catchphrases. Deep in the sewer of our hearts, amidst roundhouse kicks and impossibly yellow April O’Neil jumpsuits, they carved out a place for themselves, and more than thirty years later, their ooze still remains in the form of reimagined shows, new movies and billions of dollars worth of merchandise. And despite all the success, they're still just heroes in a half-shell, and they're green. (Hey, get a grip.)</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="S9Zz5YH6fZbChmD2XZAcA5" name="" alt="Spongebob Squarepants" src="https://cdn.mos.cms.futurecdn.net/S9Zz5YH6fZbChmD2XZAcA5.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Nickelodeon)</span></figcaption></figure><h2 id="28-spongebob-squarepants-1999-present">28. SpongeBob SquarePants (1999-Present)</h2><p>In 1999, if you told someone a silly gap-toothed sponge would one day be as recognizable to the children of the world as Mickey Mouse or Bugs Bunny, they would’ve laughed. And yet, <em>SpongeBob SquarePants</em> continues to entertain the children of today, and has been lovingly embraced by the Millenials and Gen-Z who grew up with it as well. The internet is loaded with memes dedicated to the franchise, and there’s still plenty of debate as to <a href="https://www.cinemablend.com/television/1684060/whats-in-a-krabby-patty-heres-what-the-spongebob-producer-knows"><u>what is in a Krabby Patty</u></a>. With plenty of episodes and even some spinoffs, it feels like SpongeBob and friends will be entertaining children for many years to come. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="QFUrxuqYPAykbB8Km9c8sJ" name="" alt="The Rugrats Passover Episode" src="https://cdn.mos.cms.futurecdn.net/QFUrxuqYPAykbB8Km9c8sJ.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Nickelodeon)</span></figcaption></figure><h2 id="27-rugrats-1991">27. Rugrats (1991)</h2><p><em>Rugrats</em> premiered in 1991 on Nickelodeon as one of the first three Nicktoons, aimed at a younger audience than <em>Doug</em> and <em>The Ren & Stimpy Show</em>. It was a staple for kids throughout the ‘90s and into the early 2000s, with nine seasons about the adventures of babies Tommy, Chuckie, Phil, and Lil, with regular appearances from characters like the parents, Angelica, and (eventually) Dil. The show could swing from silly to serious, with memorable episodes that ranged from covering the grief of losing a parent to the spectacular Reptar On Ice, with a dinosaur love song that still rings in the hearts of plenty of ‘90s kids. There’s a reason why this Nicktoon show went on to inspire <em>Rugrats</em> movies and a 2021 reboot.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="iRte6DZwztGCVvsJJSNVvk" name="" alt="Kaley Cuoco's animated Harley Quinn" src="https://cdn.mos.cms.futurecdn.net/iRte6DZwztGCVvsJJSNVvk.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: HBO Max)</span></figcaption></figure><h2 id="26-harley-quinn">26. Harley Quinn</h2><p>What happens when you blend DC Comics mythology with the kind of crass adult comedy you find in shows like <em>Family Guy</em> and <em>South Park</em>? You get Harley Quinn, which follows Kaley Cuoco’s version of The Joker’s former squeeze going on adventures with Lake Bell’s Poison Ivy, her best-friend-turned-girlfriend, and getting into hijinks with fellow supervillains and superheroes alike. One doesn’t need to be a hardcore DC fan to appreciate <em>Harley Quinn</em>, although that definitely helps with catching the deep-cut references and Easter eggs. As long as you're in the mood for clever writing and all the edgy, not-safe-for-kids humor you could ask for, <em>Harley Quinn</em> is a must-[censored]-watch.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="s3rqfUTU4eNBUibr3F76bm" name="" alt="Mabel and Dipper in Gravity Falls." src="https://cdn.mos.cms.futurecdn.net/s3rqfUTU4eNBUibr3F76bm.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Disney Channel)</span></figcaption></figure><h2 id="25-gravity-falls">25. Gravity Falls</h2><p>With hands on our bible of beasts, baubles and bafflement — Journal 3, naturally — we can solemnly swear that <em>Gravity Falls</em> is the weirdest, wildest and gobblewonkiest project that’s ever come out of Disney, bursting through the castle doors like rainbows from a gnome’s mouth. Created by Alex Hirsch, the mystery-hinged funfest centers on a pair of siblings, Jason Ritter’s Dipper and Kristen Schaal’s Mabel, living with their kooky and perhaps unstable great uncle, Grunkle Stan (voiced by Hirsch). And for anyone who loves codes, hidden messages, deep lore, crytozoology, conspiracies, and everything sharing that fringe space, <em>Gravity Falls</em> is the holy grail of animated shows. (And that grail is filled with Pitt Cola.)</p><p>Despite nearly universal love and acclaim, Disney cut <em>Gravity Falls</em>’ run short at just two seasons, although the actual supplementary <em>Journal 3</em> (which Hirsch co-wrote) is expansive and unique enough of an experience to at least count as a one-off special. There’s still hope that fans will one day go on more adventures in the Mystery Shack with Soos, assuming Bill Cipher doesn’t muck anything up, but even if these 40 episodes are all that ever get produced, it was perfection.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="RnbiUFr5XgKnSvhhMskx3C" name="" alt="The Boondocks Best of clips compilation." src="https://cdn.mos.cms.futurecdn.net/RnbiUFr5XgKnSvhhMskx3C.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Adult Swim)</span></figcaption></figure><h2 id="24-the-boondocks">24. The Boondocks</h2><p>Aaron McGruder’s adaptation of his own comic strip, <em>The Boondocks</em>, is a must-watch for those trying to better understand racial relations, culture, and racism in the United States. With the help of some <a href="https://www.cinemablend.com/television/2549452/regina-king-interesting-facts-about-the-watchmen-star"><u>voice acting from Regina King</u></a>, Riley and his brother Huey navigate the Black experience of living in a predominantly white suburb.</p><p><em>The Boondocks</em> thrived on taking hot-button issues and forcing the viewer to think about not just the issue but their own reaction and perspective of that issue. <em>The Boondocks</em> deserves applause for how it pushed the envelope in its four seasons and offered thoughtful commentary in a way few other animated shows can. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="9NG6t5SXAGyWTAwiTeqfaL" name="" alt="Martian Manhunter, Hawkgirl, Green Lantern, Wonder Woman, Flash, Superman and Batman in Justice League animated series" src="https://cdn.mos.cms.futurecdn.net/9NG6t5SXAGyWTAwiTeqfaL.jpeg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Warner Bros. Animation)</span></figcaption></figure><h2 id="23-justice-league">23. Justice League</h2><p>Superheroes joining forces in the DC Animated Universe wasn’t anything new prior to 2001 thanks to special pairings in <em>Superman: The Animated Series</em> and <em>Batman Beyond</em>’s “The Call” two-parter, but <em>Justice League</em> placed teamwork front and center. Viewers watched Superman, Batman, Wonder Woman, The Flash, Green Lantern, Martian Manhunter and Hawkgirl vanquish terrestrial, alien and magical threats together, and it was a blast. </p><p><em>Justice League</em> continues to be appreciated for its crisp animation, mature storytelling and stellar character development, as well as for transforming John Stewart from a B-list character to the definitive Green Lantern for a generation. <em>Justice League</em> makes an effective crash course for those wanting to dive into DC lore without having read any of the comics.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="KJYVyTMXqvt7sWJyMuej9i" name="" alt="Main characters of Star Trek: Lower Decks" src="https://cdn.mos.cms.futurecdn.net/KJYVyTMXqvt7sWJyMuej9i.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Paramount+)</span></figcaption></figure><h2 id="22-star-trek-lower-decks">22. Star Trek: Lower Decks</h2><p>Being such a well known and praised franchise for decades, die-hard fans were quite surprised when it was <a href="https://www.cinemablend.com/television/2550039/star-trek-lower-decks-first-trailer-features-borg-blast-shields-and-hilarious-action"><u>announced back in 2019</u></a> that the <em>Star Trek</em> franchise would be taking a shot at an adult comedy with a brand new animated show, <em>Star Trek: Lower Decks</em>. Written by <em>Rick and Morty</em>’s Mike McMahan, the show takes place in the 24th century and instead of focusing on the high-ranking officers on the Bridge Crew, it gives viewers a glimpse into the “lower deck” officers with the more humble jobs that keep the ship running…smoothly? The show often references the rest of the Star Trek earlier entries and breaks down sci-fi tropes, often in a very NSFW way, and should delight both seasoned and new fans alike. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="WDgfHQPQwLi6VuCN952m4Q" name="" alt="Sailor Moon with her Sailor Scouts" src="https://cdn.mos.cms.futurecdn.net/WDgfHQPQwLi6VuCN952m4Q.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Toei Animation)</span></figcaption></figure><h2 id="21-sailor-moon">21. Sailor Moon</h2><p>If you’re of a certain age, <em>Sailor Moon</em> may be the first anime you ever saw in your entire life. It’s one of those <a href="https://www.cinemablend.com/television/2568471/dragon-ball-z-and-other-classic-anime-from-the-80s-and-90s-and-how-to-watch-them"><u>‘90s anime</u></a> that was sandwiched between <em>Fist of the North Star</em> in the ‘80s, and the explosion that was <em>Dragon Ball Z</em>, and <em>Pokemon</em> in the later ‘90s. Even so, <em>Sailor Moon</em> still managed to stand out, and it still stands out today. It may be because Serena (or Usagi, <a href="https://www.cinemablend.com/television/subtitles-vs-dubbed-why-i-prefer-subtitles-much-more-when-watching-anime"><u>if you prefer sub over dub</u></a>) is so dang loveable. As is her relationship with Darien (AKA, <a href="https://www.youtube.com/watch?v=eeffCAQJnq8">Tuxedo Mask</a>). </p><p>And of course, we can’t forget the many other Sailor Scouts, as they all have their own unique personalities and inner worlds. In truth, <em>Sailor Moon</em> is the kind of cartoon that appeals to both young girls, <a href="https://www.cinemablend.com/television/2562448/reasons-why-i-a-man-in-my-30s-will-always-prefer-sailor-moon-over-dragon-ball-z"><u>but also grown men in their ‘30s and ‘40s</u></a>, and really, we wouldn’t have it any other way.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="YzaYgXgLmTYcsfybhsntKK" name="" alt="One Piece logo" src="https://cdn.mos.cms.futurecdn.net/YzaYgXgLmTYcsfybhsntKK.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Fuji TV)</span></figcaption></figure><h2 id="20-one-piece">20. One Piece</h2><p>Shows like <em>One Piece</em> don’t come along often, and really, we’re not sure there is any other show on television that’s like it. It’s one thing to have an astronomically high episode count, but quite another for that story to be serialized and tell a great story of a pirate adventure that’s been wowing viewers for over two decades. The character development and growth of the Straw Hat Pirates and the world-building it boasts makes this an easy choice for top-tier anime, and it’s great that Netflix finally took notice and made an <a href="https://www.cinemablend.com/streaming-news/i-watched-one-piece-and-its-everything-i-could-have-wanted"><u>equally enjoyable live-action series</u></a>. </p><p>It’s a modern-day epic story equatable to <em>Gilgamesh</em> or <em>Beowulf</em>, and feels like a lived-in universe more than any other anime out there. It’s totally worth the time investment for those who feel overwhelmed by tackling the 1000+ episodes of this ongoing series. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="ArKYqcKEWkyKQHynDrbaoR" name="" alt="Jay Sherman chatting it up on The Critic" src="https://cdn.mos.cms.futurecdn.net/ArKYqcKEWkyKQHynDrbaoR.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: ABC/Fox)</span></figcaption></figure><h2 id="19-the-critic">19. The Critic</h2><p><em>The Critic</em>, which revolves around New York film critic, Jay Sherman <a href="https://www.google.com/url?q=https://www.cinemablend.com/news/2571580/a-league-of-their-own-what-the-cast-is-up-to-now" target="_blank"><u>(voiced by </u><u><em>A League of Their Own’</em></u><u>s Jon Lovitz)</u></a> sometimes hits way too close to home. What we mean is, with many of us being critics ourselves, a lot of Jay’s fussy qualms about movies seem super spot on, such as the eye roll he gave to the made-up movie, <a href="https://www.google.com/url?q=https://www.youtube.com/watch?v%3DLu7PxhwDGqw&sa=D&source=editors&ust=1709227539456976&usg=AOvVaw3KG5sZJR5beMZ0zluxjPuk" target="_blank"><u><em>Beverly Hills RoboCanine Cop and a Half 2</em></u></a> (Starring Clint Eastwood!). </p><p>But that’s just the beauty of <em>The Critic</em>, because even though Jay was often fed up with having to review so many mediocre movies, he still loved his job, and stayed a movie fan to his core. Which, again, hits very close to home. Plus, it didn’t hurt that the series had <em>The Simpsons</em> writers, Al Jean and Mike Reiss as showrunners. It stinks!...that we don’t have any new episodes of <em>The Critic</em> to watch these days.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="Akzuritgu38yLy3qgpoua8" name="" alt="Daria on Daria" src="https://cdn.mos.cms.futurecdn.net/Akzuritgu38yLy3qgpoua8.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: MTV)</span></figcaption></figure><h2 id="18-daria">18. Daria</h2><p>Daria once described herself to a therapist as actively working to make people dislike her. She’s not wrong. <em>Daria</em>'s main character is, at times, deeply unlikeable. She speaks as if she’s a detached observer into her own life, making callous observations in a dry, dispassionate voice. She’s like a real life narrator, condescendingly commenting on the world around her as everyone else plays volleyball and talks about who they’re going to prom with. </p><p>Despite all her efforts, however, it’s impossible to hate Daria because she’s really funny and also not wrong most of the time. High school is often pretty stupid and populated with try-hards who don’t know themselves or have any idea where they’re going. Listening to Daria judge them feels like therapy, even if, deep down, we know she’s just as lost as they are.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="WNg7yPn8ed8JvJjBQXVEwC" name="" alt="Two of the main characters of Over the Garden Wall." src="https://cdn.mos.cms.futurecdn.net/WNg7yPn8ed8JvJjBQXVEwC.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Cartoon Network)</span></figcaption></figure><h2 id="17-over-the-garden-wall">17. Over The Garden Wall</h2><p>What’s most impressive about <em>Over The Garden Wall</em> is just how effectively it slips under your skin and rattles you. The familiar sibling dynamic between Wirt (Elijah Wood) and his little brother Greg (Collin Dean) is disarming, as are the fantasy elements and talking animals… but never forgotten is the terror that comes from the show’s central premise: two boys getting lost in the woods and trying to find their way home. Each chapter starts with a light touch, but ends up gripping you by the throat and invading your nightmares.</p><p>The episodes brim with fantastic and horrific imagination - from the shadowy beasts that lead souls astray to the disturbing Auntie Whispers (voiced brilliantly by John Cleese). There are only 10 episodes and none of them run over 12 minutes, but <em>Over The Wall</em> leaves a deep impression, and it’s wonderful to revisit annually during Spooky Season.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="3W3EZgRskRxVeAHoRyDXvG" name="" alt="Boomhauer, Hank, Dale and Bill in king of the hill" src="https://cdn.mos.cms.futurecdn.net/3W3EZgRskRxVeAHoRyDXvG.jpeg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: 20th Century Fox)</span></figcaption></figure><h2 id="16-king-of-the-hill">16. King of the Hill</h2><p>I tell you what, it’s hard to get better than King of the Hill. The long-running hit (which has a Mike Judge-led revival coming to Hulu soon), focused on Hank, Peggy and their son Bobby Hill, and their day to day life in the small town of Arlen, Texas. This slice-of-life animated show used something a lot of people probably take for granted - the absurdities of relationships, work, growing up, marriage and other aspects of daily life - turned them up to 11 and made every episode across 13 seasons feel like we were laughing at our own friends and family. <br><br>Don’t we all know at least one person obsessed with lawn care? Or one boy who ain’t right? If not, you’ll certainly wish you knew the residents of Rainey Street and could call them neighbors, because mundane, working class life has never looked like so much looney fun.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.33%;"><img id="BLCUD9djHVwyhT7vn3ipNc" name="" alt="Mickey Mouse and pet fish" src="https://cdn.mos.cms.futurecdn.net/BLCUD9djHVwyhT7vn3ipNc.jpg" mos="" align="middle" fullscreen="" width="1280" height="721" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Disney)</span></figcaption></figure><h2 id="15-mickey-mouse-2013-shorts">15. Mickey Mouse (2013 shorts)</h2><p>Mickey Mouse is one of the most iconic characters in the history of animation. He’s been everywhere and done everything. What made the new series of shorts that began in 2013 and ended in 2023 special wasn’t that they did anything differently, (though certainly the visual style was completely new for the character) it was that they went back to the beginning and let Mickey be the Mickey he was always designed to be.</p><p>The modern run of shorts, simple called <em>Mickey Mouse</em>, let the big-eared protagonist be the hero, but they also let him be silly, angry, surprising, and ridiculous. They pack more gags into a five-minute short than would seem possible. The shorts were new, but also served as <a href="https://www.cinemablend.com/interviews/unexpected-bob-iger-decision-helped-wonderful-world-of-mickey-mouse"><u>throwbacks to earlier Mickey eras</u></a> when the character had more creative freedom before he became the icon we know. They were a breath of fresh air after decades of a stagnant and sterilized mouse.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="aEFqfDpq7M5SihgQZeWXyL" name="" alt="From left to right: Bolin, Mako and Korra ready for battle in The Legend of Korra." src="https://cdn.mos.cms.futurecdn.net/aEFqfDpq7M5SihgQZeWXyL.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit:  Nickelodeon)</span></figcaption></figure><h2 id="14-the-legend-of-korra">14. The Legend Of Korra</h2><p>There is sometimes debate on whether <em>Avatar: The Last Airbender</em> or its follow-up series, <em>The Legend of Korra</em>, is the better cartoon. But, when it comes to us, all we have to say is, <a href="https://www.cinemablend.com/television/2495110/avatar-the-last-air-bender-and-the-legend-of-korra-every-season-ranked"><u>why not both</u></a>? Because honestly, you can’t lose with either series. That said, <em>The Legend of Korra</em> definitely is special in its own right. This is a more grown-up take on the world of <em>Avatar</em>, where each season introduces a new threat to our heroine, Korra (<a href="https://www.cinemablend.com/television/2552536/would-the-voice-of-korra-ever-come-back-for-the-role-heres-what-the-voice-actress-had-to-say"><u>Voiced by the magnificent Janet Varney</u></a>). </p><p>With each season, however, we see Korra adapt and change in ways that Aang never got to do, which is enhanced by Korra’s fantastic Team Avatar of Bolin, Mako, and of course, Asami. Oh, and speaking of Asami, we’d be remiss if we didn’t mention <a href="https://www.cinemablend.com/television/why-korrasami-from-the-legend-of-korra-remains-a-groundbreaking-lgbtq-couple"><u>how groundbreaking this show was</u></a>, as Korrasami is still one of our favorite TV couples of all time.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="nVpxQJhoNfgaa5fwLywuua" name="" alt="kyle, stan, cartman and kenny on South Park season 21" src="https://cdn.mos.cms.futurecdn.net/nVpxQJhoNfgaa5fwLywuua.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Comedy Central)</span></figcaption></figure><h2 id="13-south-park">13. South Park</h2><p>Possibly the <a href="https://www.cinemablend.com/television/2482177/south-park-the-9-most-controversial-episodes-ever"><u>most controversial animated show of all time</u></a>, <em>South Park</em>. With 26 seasons under their belt, Trey Parker and Matt Stones’ on Comedy Central follows the story of four young boys and the typically pop-culture chaos that surrounds them. The show’s intro blatantly states that the show “...should not be viewed by anyone.” South Park pulls no punches and gives no f’s. T</p><p>The creators have pulled some crazy stunts in the past, like attending the <a href="https://www.youtube.com/watch?v=Og7yI6Uf3wI"><u>2000 Oscars while being nominated, wearing dresses, and high on LSD</u></a>. They have also <a href="https://www.cinemablend.com/television/2457487/south-park-is-apparently-trying-to-get-south-park-cancelled"><u>attempted to get their own show canceled</u></a>, been <a href="https://www.cinemablend.com/television/2481744/south-park-creators-react-to-china-banning-series-after-band-in-china-episode"><u>banned in China</u></a>, as well as hitting a television milestone by going “bleep-free” with the use of <a href="https://www.cinemablend.com/television/1584740/south-park-recently-hit-an-f-bomb-milestone-get-the-details"><u>the “f-bomb” live on air</u></a>. It’s a show that could not be launched today, but since it has such huge weight in the zeitgeist, expect to see some more offensive Colorado antics for some time.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="vXpjXYg22sfVxHxEQuuRcH" name="" alt="Ahsoka Tano appears in the Season 1 finale of Star Wars Rebels." src="https://cdn.mos.cms.futurecdn.net/vXpjXYg22sfVxHxEQuuRcH.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Disney XD)</span></figcaption></figure><h2 id="12-star-wars-rebels">12. Star Wars Rebels</h2><p><em>Star Wars Rebels</em> picked up the action set in the galaxy far, far away after <em>The Clone Wars</em> ended, and the animated series ran from 2014-2018 on Disney XD to expand on the era ahead of <em>Rogue One: A Star Wars Story</em> with a found family of original characters. Not only did the show prove that <em>Star Wars</em> doesn’t need to rely on legacy characters like Obi-Wan Kenobi and Anakin Skywalker to tell a fantastic story and deliver arguably <a href="https://www.cinemablend.com/television/2455524/why-star-wars-rebels-killed-that-major-character-before-the-series-finale">one of the best deaths</a> in the franchise’s history, but it set up some stellar stories that are being <a href="https://www.cinemablend.com/star-wars/ahsoka-recreated-iconic-star-wars-rebels-scene-more-moments-want-live-action">expanded in live-action with <em>Ahsoka</em></a>. </p><p>There was no certainty that <em>Rebels</em> would succeed back in the beginning despite the popularity of <em>The Clone Wars</em>, but the story was solid during its original run and stands the test of time for first-time watchers and re-watchers alike. And its characters, ships and plots have remained core to the universe even beyond its conclusion.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="PfWxcAsjmHo2Nk7R7DJiWZ" name="" alt="Omni-Man in Invincible." src="https://cdn.mos.cms.futurecdn.net/PfWxcAsjmHo2Nk7R7DJiWZ.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Amazon Prime)</span></figcaption></figure><h2 id="11-invincible">11. Invincible</h2><p><em>Invincible</em> was released for those with an <a href="https://www.cinemablend.com/streaming-news/amazon-prime-subscription-the-plan-the-price-and-whats-included" target="_blank">Amazon Prime subscription</a> during the height of superhero mania. Despite concerns about <a href="https://www.cinemablend.com/superheroes/marvel-cinematic-universe/marvels-nia-dacosta-james-gunn-same-page-superhero-fatigue" target="_blank">superhero fatigue</a>, the animated series carved stands out within the genre. Namely by being the animated answer to <em>The Boys</em>, and being an R-rated and wildly violent cartoon show. <em>Invincible</em> focuses on the title character aka Mark Grayson who is a young person coming into his own as a wildly popular hero who boasts the same powers, if not the same prowess, as his father Omni- Man, who is revealed to be something quite a bit more dangerous than anyone readily expected.</p><p>Adapted rather faithfully from Robert Kirkman and Cory Walker's comic book, the story is emotional, the action sequences are bloody and brutal, and <a href="https://www.cinemablend.com/television/2564872/robert-kirkmans-invincible-voice-cast-whos-voicing-amazons-comic-book-superhero-show" target="_blank"><em>Invincible</em>’s voice cast</a> is led by A-list talent like Steven Yeun, J.K. Simmons, Sandra Oh, and more. And the show is so popular that <a href="https://www.cinemablend.com/superheroes/invincibles-omni-man-mortal-kombat-1-shows-most-brutal-moments-video" target="_blank">Omni-Man spawned a character in <em>Mortal Kombat 1</em></a>.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="M6r7hefoB7jqcCFekEVp2R" name="" alt="Batman, Superman, Wonder Woman, Flash, Green Lantern, Martian Manhunter and Hawkgirl in Justice League Unlimited" src="https://cdn.mos.cms.futurecdn.net/M6r7hefoB7jqcCFekEVp2R.jpeg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Warner Bros. Animation)</span></figcaption></figure><h2 id="10-justice-league-unlimited">10. Justice League Unlimited</h2><p>Everything that was great about <em>Justice League</em> got ratcheted up a notch with <em>Justice League Unlimited</em>. Thanks to the team’s founding heroes expanding its ranks — minus Hawkgirl, who returned later in Season 1 — this continuation allowed the DC Animated Universe to shine the spotlight on even lesser-known heroes, from Green Arrow and The Question to Booster Gold and Huntress. Like its predecessor, the show wholeheartedly embraced its printed page while also putting unique spins on its starring protagonists and antagonists. </p><p>Although there were various standalone episodes peppered throughout <em>Justice League Unlimited</em>, the show was at its best when delving into its serialized stories that built off plot threads from the previous DC Animated Universe shows, namely the Cadmus and Secret Society arcs. That makes <em>Unlimited</em> arguably feel like the most comic book-y entry in this shared continuity. While the DCAU would be revisited a handful of other times following the show’s conclusion, <em>Unlimited</em> definitely marked the end of an era, and it stuck the landing wonderfully.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="nQPAm4kMyRNY6BR4ABBLRN" name="" alt="Phineas and Ferb in Phineas and Ferb." src="https://cdn.mos.cms.futurecdn.net/nQPAm4kMyRNY6BR4ABBLRN.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Disney)</span></figcaption></figure><h2 id="9-phineas-and-ferb">9. Phineas and Ferb</h2><p>The concept of two brothers spending their summer vacation trying to figure out a way to spend it comes with endless possibilities, and <em>Phineas and Ferb</em> explored them creatively and expertly. Following a formula where every episode the titular characters are always finding an over-the-top thing to do or build. Meanwhile, their sister Candace tries to bust them while their pet platypus Perry goes on a mission to stop his nemesis Dr. Doofenshmirtz and his latest -enator. <br><br>Over the years, <em>Phineas and Ferb</em> mastered its formula and had a blast with it. Watching the brothers build a roller-coaster, create a backyard beach, get their parents' favorite band back together and oh so much more was not only fun but creatively invigorating. Not to mention, many episodes also featured incredible original music – like the Emmy-nominated song “<a href="https://www.youtube.com/watch?v=KTdFszcZp-I"><u>Ain’t Got Rhythm</u></a>” – meaning you’ll be humming along and thinking about this show long after the episode ends. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="DYm8LJ4UtNAcxEapyWx6X" name="" alt="Bugs Bunny in Looney Tunes." src="https://cdn.mos.cms.futurecdn.net/DYm8LJ4UtNAcxEapyWx6X.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Warner Bros.)</span></figcaption></figure><h2 id="8-looney-tunes">8. Looney Tunes</h2><p>To describe <em>Looney Tunes</em> as a classic is completely appropriate, and yet, somehow not quite enough. This collection of animated shorts (produced from 1930 to 1969 and then revived in the late 1970s) has provided generations of audiences with wacky adventures featuring some of the most recognizable and quotable cartoon characters ever created. Even if you’ve only seen a handful of the many, many cartoons made by Warner Bros., you likely know that Bugs Bunny usually outsmarts everyone, Sylvester and Tweety are hilarious adversaries, Daffy Duck is at his funniest when he’s angry or on the losing end of anything, and that Roadrunner is way more trouble than it’s worth to Wile E. Coyote.<br><br><em>Looney Tunes</em> is yet another example of how something could, technically, be pleasantly silly enough for kids, but just mature enough to get and keep the attention of adults. (Who doesn’t know what it’s like to repeatedly miss your target like Elmer Fudd?) When you watch one of these belly-laugh inducing entries, the only thing stopping you from watching another (and another) will be a power outage… That’s a joke, son!</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="LEGjLGsAvyLyrbYfzbfTDH" name="" alt="Rick and Morty poppin champagne" src="https://cdn.mos.cms.futurecdn.net/LEGjLGsAvyLyrbYfzbfTDH.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Adult Swim)</span></figcaption></figure><h2 id="7-rick-and-morty">7. Rick and Morty</h2><p>A decade ago, if you asked us to name our Top Five most thoroughly inventive, consistently thrilling, amusingly thought-provoking, and deeply moving science-fiction series, we would have never guessed an Adult Swim original comedy would make the cut. Nevertheless, <em>Rick and Morty</em> — co-created by the <a href="https://www.cinemablend.com/television/rick-and-morty-characters-that-will-need-to-be-recast-following-justin-roilands-firing"><u>now-fired Justin Roiland</u></a> and Dan Harmon — has risen above its crude animation, and even cruder humor, to be widely remembered as, not just one of the <a href="https://www.cinemablend.com/television/10-Funniest-Sci-Fi-TV-Shows-All-Time-71442.html"><u>funniest sci-fi TV shows</u></a>, but among the genre’s all-time finest.</p><p>It is no surprise the series was bred from a <em>Back to the Future</em> parody short, as the pairing of alcoholic scientist Rick Sanchez with his grandson, Morty Smith, feels like a more volatile Marty and Doc situation, which is also just one of the many ways the series brilliantly pokes fun at and pays homage to pop culture. However, the <a href="https://www.cinemablend.com/television/2486482/10-best-rick-and-morty-episodes-ranked"><u>best </u></a><a href="https://www.cinemablend.com/television/2486482/10-best-rick-and-morty-episodes-ranked"><u><em>Rick and Morty</em></u></a><a href="https://www.cinemablend.com/television/2486482/10-best-rick-and-morty-episodes-ranked"><u> episodes</u></a> — in addition to introducing eye-popping, otherworldly, and downright absurd concepts — honor the series’ more relatable themes, such as family and existential dread, which cleverly sneak up on you while you experience the duo's latest crazy adventure through time and space.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="A3DZi3EfNpemZMzKPi6VpM" name="" alt="Dina's Titan form in Attack on Titan." src="https://cdn.mos.cms.futurecdn.net/A3DZi3EfNpemZMzKPi6VpM.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Funimation)</span></figcaption></figure><h2 id="6-attack-on-titan">6. Attack On Titan</h2><p>There’s a lot of great anime out there, <a href="https://www.cinemablend.com/streaming-news/spy-x-family-why-its-the-most-wholesome-anime-you-should-watch-right-now"><u>from wholesome shows like </u></a><a href="https://www.cinemablend.com/streaming-news/spy-x-family-why-its-the-most-wholesome-anime-you-should-watch-right-now"><u><em>Spy X Family</em></u></a> to much more action-heavy series like <em>Demon Slayer</em> and <em>JoJo’s Bizarre Adventure</em>. But when it comes to anime that just generally rivals some of the greatest television shows of all-time, then look no further than <em>Attack on Titan</em>, which we once called the <a href="https://www.cinemablend.com/television/reasons-why-attack-on-titan-is-the-best-under-the-radar-show-on-television"><u>best under-the-radar show on television</u></a>. Because no show swerved like <em>Attack on Titan</em> did, and it all falls upon its protagonist/antagonist, Eren Yeager, who the audience is firmly behind…until we aren’t. </p><p>That’s right, <em>Attack on Titan</em> initially seems very simple in premise — Titans bad, people good — but soon changes dramatically to the point where we wonder if we may have had it all wrong the entire time. Are the titans were the ones who were misunderstood, and the humans were the bad guys. Plus, this is the rare exception where <a href="https://www.cinemablend.com/streaming-news/why-i-think-the-attack-on-titan-anime-ending-will-be-looked-back-upon-much-more-fondly-than-the-mangas-ending"><u>the anime may be superior to the manga</u></a>, and if you know anything about manga, that is no small feat. This is an anime for the ages.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="LzqwzCoZCHza3R676MMs8T" name="" alt="Bluey The Pool episode" src="https://cdn.mos.cms.futurecdn.net/LzqwzCoZCHza3R676MMs8T.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: The Pool)</span></figcaption></figure><h2 id="5-bluey">5. Bluey</h2><p><em>Bluey</em> has simply become must-watch programming for families, and don’t be surprised when Mom and Dad find themselves just as entertained as the little ones. The infectious theme song ropes you in as it introduces Mum (Chilli), Dad (Bandit), little sister Bingo and big sister Bluey, but it’s the heart-filled interactions between the Blue Heelers that have kept people coming back. Some episodes are laugh-out-loud funny — “I slipped on my beans!” — and others will hit you right in the feels and cause tears to flow freely.</p><p>Parents have become endeared to <em>Bluey </em>because it <a href="https://www.cinemablend.com/television/ways-that-blueys-father-teaches-me-to-be-a-better-father-myself"><u>inspires us to be better</u></a>. It encourages us to play with our kids and gives us permission to act silly in public. Why care what strangers think if you can make your kids laugh, right? But <em>Bluey </em>also shows the harder moments. Sometimes Bandit and Chilli don’t have time to play. Sometimes they don’t know what to say or just need some peace and quiet after partying too hard on New Year’s Eve. We need permission to want those things in real life, too.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="T2BFEEeM9xC4ucpNrS6SXH" name="" alt="The Simpsons couch" src="https://cdn.mos.cms.futurecdn.net/T2BFEEeM9xC4ucpNrS6SXH.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: 20th Television)</span></figcaption></figure><h2 id="4-the-simpsons">4. The Simpsons</h2><p><em>The Simpsons</em> is the most popular and successful animated show in history because it’s hilarious in so many different ways. No matter what your sense of humor is, there’s almost certainly a Simpsons character that’s funny in the exact way you’re looking for. From highbrow literary references thrown out as asides to people falling over and getting injured in embarrassing or gruesome ways, and everything in between, each episode is jam-packed with jokes intended to do very different things and to appeal to very different people.<br><br>If it happened in a lesser show, it might feel like pandering, but with <em>The Simpsons</em>, the "whatever sticks" approach always felt like layers and variance. That’s a testament to the quality of the writing. Most shows that try to do too much are overtly better at one of the things they’re trying to do, which makes the rest seem less than or out of place. Not <em>The Simpsons</em>. Thanks to fantastic, complicated leads and the funniest supporting network of side characters in TV history, the writers can be funny in so many unique, challenging, satirical, irreverent and sometimes prophetic ways, and they have for more than 750 delightful episodes.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="e6PSunRVXp33Dw9neTLSBZ" name="" alt="Zach Tyler Eisen in Avatar: The Last Airbender (2005)" src="https://cdn.mos.cms.futurecdn.net/e6PSunRVXp33Dw9neTLSBZ.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Nickelodeon Animation Studio)</span></figcaption></figure><h2 id="3-avatar-the-last-airbender">3. Avatar: The Last Airbender</h2><p>From scathing commentary about imperialism to discussions of spirituality, trauma and extinction, Nickelodeon's <em>Avatar: The Last Airbender</em> packs deep philosophical meaning into its animated stories. This universe, centered around people boasting the ability <a href="https://www.cinemablend.com/television/how-bending-in-avatar-the-last-airbender-works"><u>to bend elements</u></a>, follows Avatar Aang on his journey to master the elements and defeat the Fire Lord. This series from Michael Dante DiMartino and Bryan Konietzko is a masterful classic, filled with fun side-quests like the trio’s journey to Omashu, as well as complex politics surrounding the <a href="https://www.cinemablend.com/streaming-news/avatar-the-last-airbender-zuko-and-the-royal-fire-nation-family-explained"><u>Royal Fire Nation family</u></a>, sassy characters (we’re of course talking about Sokka and Toph), insanely well-developed story arcs like Zuko’s, and it's all taied together with mind-boggling action, <br><br>Like the Avatar, <em>ATLA</em> gets stronger with time, and as Aang mastered the elements, the series grew with him. No matter how old you are, this series hits hard, and the more you watch it the better it gets. <em>Avatar: The Last Airbender</em> seems destined to always feel timeless, and like the Avatar’s powers, this show will likely continue to be passed down through generations for years to come.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="7k6vgPovjJ5iHRgyqfPNUA" name="" alt="Will Arnett and Weird Al Yankovic on BoJack Horseman" src="https://cdn.mos.cms.futurecdn.net/7k6vgPovjJ5iHRgyqfPNUA.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="2-bojack-horseman">2. BoJack Horseman</h2><p>It’s understandable if you watch the first episode of <em>BoJack Horseman</em> and don’t quite click with it. It’s a show that throws you headfirst into its world  – providing a deep inside look at Hollywood and celebrity in a reality where humans coexist with humanoid animals. That being said, as one of the first Netflix original creations, it’s a series that greatly benefited from the streamer’s binge model, as to dig deeper into the show is to fall in love with it and everything it has to say.</p><p>All six seasons of <em>BoJack Horseman</em> are witty, clever, and hilarious, with countless background gags that make it incredibly rewarding on rewatch – but what makes it special is just how real it is. The aesthetic may be silly, but the characters are all ultimately broken people and there is an unflinching and powerful examination of their individual damage over the course of the show. The penultimate episode of every season manages to be as emotionally devastating as anything that Hollywood has ever produced for the small screen, and each one is both shocking and mesmerizing.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="mgJwAnCs2XL5HJFJWAJK7a" name="" alt="Kevin Conroy on Batman: The Animated Series" src="https://cdn.mos.cms.futurecdn.net/mgJwAnCs2XL5HJFJWAJK7a.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Warner Bros.)</span></figcaption></figure><h2 id="1-batman-the-animated-series">1. Batman: The Animated Series</h2><p>Unquestionably one of the best examples of any animated TV show appealing to both kids and adults, <em>Batman: The Animated Series</em> continues to stand as perhaps the greatest triumph in the media history of DC Comics’ Caped Crusader. <em>BTAS</em>, and by extension <em>The New Batman Adventures</em>, followed in the footsteps of the Tim Burton Batman movies by bringing the character back to his darker roots and inserting viewers into an anachronistic Gotham City dripping with noir flavor. Here we have a Batman who strikes fear into the hearts of criminals just as easily as he inspires the innocent. </p><p>Anchored by <a href="https://www.cinemablend.com/superheroes/batman/animated-batman-icon-kevin-conroy-is-dead-at-66-read-mark-hamills-touching-tribute"><u>the late Kevin Conroy</u></a> as Bruce Wayne, <em>Batman: The Animated Series</em> effectively walked the line of honoring the source material while also putting unique spins on characters like The Joker, Mr. Freeze and Two-Face, while also launching neo-icons like Harley Quinn, Renee Montoya and a handful of others who’ve become mythos mainstays. Even ignoring that <em>BTAS</em> launched the beloved DC Animated Universe, Bruce Timm and Eric Radomski's show serves for many as the gold(black) standard by which all other Batman adaptations are judged. 1992 may be a long time ago, but <em>BTAS</em> still feels wonderfully timeless.</p><p>Hopefully the next 80 years of animated series can stand up to the classic eras that have already come and gone, as well as everything happening currently. But for anyone who hasn't yet watched everything listed above, now you know the assignment, mmk?</p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ 32 Great TV Shows That Never Won Best Series At The Emmys ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/great-tv-shows-that-never-won-best-series-at-the-emmys</link>
                                                                            <description>
                            <![CDATA[ There are plenty of great TV shows that never won Best Series at the Emmys -- here are 32 we need to talk about. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">h4SCijqcQcYVzuFgYbU59Y</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/LvxHvFp6LSNxio9QUoCz9B-1280-80.png" type="image/png" length="0"></enclosure>
                                                                        <pubDate>Sat, 09 Dec 2023 01:04:55 +0000</pubDate>                                                                                                                                                                                                                                <category><![CDATA[Television]]></category>
                                                                                                                    <dc:creator><![CDATA[ Alexandra Ramos ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/4vCq2c3J9ZiZUXQ3hPz69T.png ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Alexandra Ramos is a Content Producer at CinemaBlend. She first started off working in December 2020 as a Freelance Writer after graduating from the Pennsylvania State University with a degree in Journalism and a minor in English. She later moved over to full-time in July of 2021, and primarily works in features for movies, TV, and sometimes video games. She is also the main person who runs both our daily newsletter, The CinemaBlend Daily, and our ReelBlend newsletter that is sent out bi-weekly to patrons.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;
&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What She&#039;s Into&lt;/strong&gt;: Alex is into many things. She loves all kinds of movies except for super sappy romantic ones - with the only redeeming case being The Notebook, and is a big fantasy nerd. She’s a huge fan of the streaming shows that have been released, and loves to watch series’ like The Witcher, Shadow &amp;amp; Bone, and more. Her all-time favorite TV show has to be a solid three-way tie between Breaking Bad, Game of Thrones and Attack on Titan - she just can’t seem to pick one. Alex is also a big Marvel nerd, and will defend Scarlet Witch until her dying day. For years, she’s been an avid gamer, primarily for the PlayStation, and has become a part of the fanbase for games like The Last Of Us, God of War, Spider-Man, and more, but that won’t stop her from playing simple games like Animal Crossing, or FPS’ like Call of Duty. Alex is also a big sports fan and considers herself a couchside coach because she will threaten to throw stuff at her TV if Penn State or the NY Giants are losing (which is often), usually with pizza in her hands.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What She&#039;s Excited About Right Now&lt;/strong&gt;: The Boys Season 4 and its spinoff, Gen V Season 2, House of the Dragon Season 2, The Bear Season 4, Fallout, and Bridgerton Season 3 because I&#039;m missing my steamy romance.&amp;nbsp;&lt;/p&gt; ]]></dc:description>
                                                                                                                                <cf:isSponsored>false</cf:isSponsored>
                <cf:hasAffiliateLinks>false</cf:hasAffiliateLinks>
                <cf:isPaid>false</cf:isPaid>
                                                                                                                                <media:content type="image/png" url="https://cdn.mos.cms.futurecdn.net/LvxHvFp6LSNxio9QUoCz9B-1280-80.png">
                                                            <media:credit><![CDATA[HBO]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[Michael K Williams as Omar on The Wire]]></media:description>                                                            <media:text><![CDATA[Michael K Williams as Omar on The Wire]]></media:text>
                                <media:title type="plain"><![CDATA[Michael K Williams as Omar on The Wire]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/LvxHvFp6LSNxio9QUoCz9B-1280-80.png" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>In a world that is surrounded by some of the best television shows ever, from the <a href="https://www.cinemablend.com/television/2564797/the-best-shows-to-binge-watch-on-netflix-right-now"><u>best programs on Netflix</u></a> to the <a href="https://www.cinemablend.com/streaming-news/best-shows-streaming-on-max"><u>best series on Max,</u></a> there have been plenty that have won Outstanding Drama, Comedy or Limited or Anthology Series at the Primetime Emmy Awards. A few I could think of are <em>Game of Thrones, The Sopranos, Breaking Bad, Ted Lasso, Modern Family</em> and many more. </p><p>There are also so many shows that have never won any of these awards. Despite their impressive reputations or stellar casts, these 32 shows have never won Best Series in any category at the Emmys. Prepare to have your mind blown.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="taQxmwSpKnZpnCUh7zYGhR" name="Sterling K. Brown and Mandy Moore.jpg" alt="Randall and Rebecca Pearson on This Is Us." src="https://cdn.mos.cms.futurecdn.net/taQxmwSpKnZpnCUh7zYGhR.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="this-is-us-xa0">This Is Us </h2><p><em>This Is Us </em>was a famous NBC show known for its brilliant storytelling and episodes that always found a way to make you cry. It was led by a brilliant <a href="https://www.cinemablend.com/television/this-is-us-cast-where-youve-seen-the-actors-before"><u><em>This Is Us </em></u><u>cast</u></a> which included Sterling K. Brown (who won an Emmy for this show), Milo Ventimiglia and more. Somehow, the series never won Outstanding Drama at the Emmys. What&apos;s even worse is Mandy Moore never won an Emmy for her portrayal of the matriarch of the Pearson family. That, in itself, is a sin. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="givjpj35KQsx5THytzPSae" name="emmy-rossum_shameless_1280 (1).jpg" alt="Emmy Rossum in Shameless." src="https://cdn.mos.cms.futurecdn.net/givjpj35KQsx5THytzPSae.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Showtime)</span></figcaption></figure><h2 id="shameless">Shameless</h2><p>Yes, I know that in the later years of <em>Shameless, </em>the episodes didn&apos;t feel the same without Emmy Rossum as part of the fearless <a href="https://www.cinemablend.com/television/2565350/shameless-what-the-cast-is-doing-next"><u><em>Shameless </em></u><u>cast</u></a>. However, the first few seasons of the dramedy became some of the best television at the time – and one of the <a href="https://www.cinemablend.com/television/2573148/the-best-showtime-shows-to-stream-right-now-including-dexter-and-shameless"><u>best Showtime shows</u></a>. And still, it never won Outstanding Comedy. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="ayYUHErW9umcCrfjuWtv7" name="Enlightened.jpg" alt="Laura Dern on Enlightened" src="https://cdn.mos.cms.futurecdn.net/ayYUHErW9umcCrfjuWtv7.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: HBO)</span></figcaption></figure><h2 id="enlightened-xa0">Enlightened </h2><p><em>Enlightened </em>only ran for two seasons, but they were full of great acting, a fun story, and so much more. Plus, it was led by the legend Laura Dern. The series, however, was never nominated for Outstanding Comedy. The only nomination that came through was for Dern, and she didn&apos;t win. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="K24mNNsLAnKut4qTFUTEpV" name="TWD_814_GP_1030_0092-RT.jpg" alt="Rick Grimes in The Walking Dead Season 8" src="https://cdn.mos.cms.futurecdn.net/K24mNNsLAnKut4qTFUTEpV.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: AMC)</span></figcaption></figure><h2 id="the-walking-dead">The Walking Dead</h2><p>Say what you want about <em>The Walking Dead, </em>but as someone who <a href="https://www.cinemablend.com/television/the-walking-dead-ranking-every-season-of-the-amc-zombie-show"><u>watched all eleven seasons</u></a> of the show, those first five were <em>excellent </em>television. The only praise this show ever got in the Emmy world was for its visual and practical effects on the zombies – but the acting and the show as a whole? It went completely over the heads of those who chose the nominations. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="2zcQsF3VyqKYEyX7Ae5age" name="Dickinson (1).jpg" alt="Hailee Steinfeld in Dickinson" src="https://cdn.mos.cms.futurecdn.net/2zcQsF3VyqKYEyX7Ae5age.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Apple TV+)</span></figcaption></figure><h2 id="dickinson-xa0">Dickinson </h2><p><em>Dickinson </em>was one of the<a href="https://www.cinemablend.com/television/2566890/the-best-apple-tv-shows-to-watch-including-ted-lasso"><u> best Apple TV+ original shows.</u></a> I fully believe this series was never nominated for Outstanding Comedy because it flew under the radar at first as one of the streaming platforms&apos; first series. Hailee Steinfeld <em>at least</em> should have garnered a nomination, but there was no love for this series. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="oe7RdEHzfDbNufCHACX5Wg" name="Screen Shot 2023-10-15 at 3.48.49 PM.png" alt="Amy Poehler as Leslie Knope" src="https://cdn.mos.cms.futurecdn.net/oe7RdEHzfDbNufCHACX5Wg.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="parks-and-recreation">Parks And Recreation</h2><p>You&apos;re probably shocked to see this on the list, but <em>Parks and Recreation </em>never won a <em>single </em>Emmy Award. The show was top-rated and well-known for its talented <a href="https://www.cinemablend.com/television/2495456/what-the-parks-and-recreation-cast-members-are-doing-now"><u><em>Parks and Recreation </em></u><u>cast,</u></a> but not even Amy Poehler won the Emmy for her lead performance in the show. And the series, while nominated twice for Outstanding Comedy, never won.  </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="RHf5PrHESRgXhxRqsBu7sY" name="Dexter.jpg" alt="Dexter close-up from opening titles" src="https://cdn.mos.cms.futurecdn.net/RHf5PrHESRgXhxRqsBu7sY.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Showtime)</span></figcaption></figure><h2 id="dexter">Dexter</h2><p>I still believe <a href="https://www.cinemablend.com/television/why-dexter-is-still-worth-rewatching-even-with-its-controversial-ending"><u><em>Dexter </em></u><u>is worth rewatching</u></a> despite its later seasons being less than stellar. But the first four seasons of <em>Dexter </em>are classic TV. The plot twists are great, the acting is fantastic, and the backstory behind the serial killer is one of the best in Showtime history. While the series was nominated for Outstanding Drama Series several times, it never won. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="SErYF9oSTfyvTpHdUz2PB6" name="Wire.png" alt="The Wire" src="https://cdn.mos.cms.futurecdn.net/SErYF9oSTfyvTpHdUz2PB6.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: HBO)</span></figcaption></figure><h2 id="the-wire">The Wire</h2><p>I know. <em>The Wire </em>is one of the best shows in HBO history and television in general. And yet, somehow, the series never won any Emmy awards. It was never even nominated for Outstanding Drama. The only praise the Television Academy ever gave it was in the form of its writing – which was excellent, understandably – but come on, only that? </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="NymqmviBV8e48iATmRdW5o" name="The Brady Bunch kids.png" alt="The Brady Bunch kids" src="https://cdn.mos.cms.futurecdn.net/NymqmviBV8e48iATmRdW5o.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Paramount Television)</span></figcaption></figure><h2 id="the-brady-bunch">The Brady Bunch</h2><p>This sitcom from the 1970s is considered one of the most well-known and created several spinoffs. It also spawned one of the best-known <a href="https://www.cinemablend.com/television/classic-tv-catchphrases-and-the-story-behind-them"><u>TV catchphrases ever</u></a> ("Marcia, Marcia, Marcia"), yet somehow, this series was <em>never </em>nominated for Outstanding Comedy -- or a single other Emmy award.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="55PRtXnGizFnpDrqpsgmQf" name="Peaky Blinders Cillian Murphy standing in a room looking stunned.jpg" alt="Cillian Murphy standing in a room, looking stunned, in Peaky Blinders." src="https://cdn.mos.cms.futurecdn.net/55PRtXnGizFnpDrqpsgmQf.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="peaky-blinders">Peaky Blinders</h2><p><em>Peaky Blinders </em>has gained a lot more popularity over the last few years thanks to the growing stardom of Cillian Murphy from the <a href="https://www.cinemablend.com/movies/christopher-nolans-updated-oppenheimer-cast-list-is-stacked-includes-robert-downey-jr-and-matt-damon"><u><em>Oppenheimer </em></u><u>cast</u></a>, but this show was one of the best the BBC had to offer. It featured <em>several </em>other major stars too, like Anya Taylor-Joy, Tom Hardy, Sam Claflin, and many more, and it was a fantastic story<em>. </em>But it was never nominated for a single Primetime Emmy Award. I&apos;m upset even writing that down. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="fWnYhcU5Prq95MYhFwK76P" name="David Tennant 14th Doctor Who.jpg" alt="David Tennant as the Fourteenth Doctor" src="https://cdn.mos.cms.futurecdn.net/fWnYhcU5Prq95MYhFwK76P.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: BBC)</span></figcaption></figure><h2 id="doctor-who">Doctor Who</h2><p><em>Doctor Who </em>is one of those shows that has ebbed and flowed in quality. Some doctors have been great, others have been forgettable. But you can&apos;t deny the impact this series has had and the stories it tells with its most excellent doctors. And yet, <em>Doctor Who </em>has never been recognized in terms of acting, writing, or anything at the Emmys. The only nomination it ever got was for Outstanding Derivative Interactive Program in 2020.  </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.33%;"><img id="rYUChbknFg9DPYqFoT7ZcN" name="Bob Odenkirk.png" alt="Bob Odenkirk as Jimmy McGill / Saul Goodman" src="https://cdn.mos.cms.futurecdn.net/rYUChbknFg9DPYqFoT7ZcN.png" mos="" align="middle" fullscreen="" width="1280" height="721" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: AMC)</span></figcaption></figure><h2 id="better-call-saul">Better Call Saul</h2><p>When <em>Better Call Saul </em>was confirmed after <em>Breaking Bad, </em>many believed it would never live up to its predecessor. Still, the prequel series about Saul Goodman was almost as good as the original – and to some, it&apos;s even better. But while <em>Better Call Saul </em>was nominated several times for Outstanding Drama, it has never won. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="BHQcaqzthhnnHUu3sxdVGa" name="Hannibal Mads Mikkelsen.jpg" alt="Mads Mikkelsen on Hannibal" src="https://cdn.mos.cms.futurecdn.net/BHQcaqzthhnnHUu3sxdVGa.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="hannibal">Hannibal</h2><p><em>Hannibal </em>was a tremendous psychological horror-thriller that aired for three seasons and told stories that would blow the minds of anyone who watched it. It was scary and psychological and everything you could want – but it was never nominated for Outstanding Drama Series. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="azwkg3JEKdfnXXe5uecbrg" name="Cheers Reference - New Girl.jpg" alt="Jess and Sam in New Girl Season 5" src="https://cdn.mos.cms.futurecdn.net/azwkg3JEKdfnXXe5uecbrg.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Fox)</span></figcaption></figure><h2 id="new-girl">New Girl</h2><p>I loved <em>New Girl </em>and will rewatch it over and over again, but it seems like the Emmys forgot about the popular sitcom series after its first season. <em>New Girl </em>was only nominated for a few awards in 2012, not even for Outstanding Comedy Series. After that, it wasn&apos;t nominated again. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="JmQckGkJCqMG4daNMzrLkh" name="Parenthood Craig T. Nelson.jpg" alt="Craig T. Nelson on Parenthood" src="https://cdn.mos.cms.futurecdn.net/JmQckGkJCqMG4daNMzrLkh.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="parenthood-xa0">Parenthood </h2><p><em>Parenthood </em>lasted six seasons and had some of the best writing about modern-day family life. It is a more dramedy version of <em>Modern Family. </em>But the only person who ever got recognition for the show at the Emmys was Jason Ritter, and that was for a guest appearance on the series. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="dXsusqBmHPdHTMCezVLe34" name="yvonne chuck.jpg" alt="Yvonne Strahovski and Zachary Levi on Chuck" src="https://cdn.mos.cms.futurecdn.net/dXsusqBmHPdHTMCezVLe34.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="chuck">Chuck</h2><p>Starring Zachary Levi, <em>Chuck </em>was the spy drama that everyone enjoyed when it first came out in 2007, and it lasted for five seasons. But despite the show&apos;s fun nature and entertaining stories, it was never nominated for Outstanding Comedy. Its stunt work did receive some praise, though. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="4A8HrE2V7kiHkJoNXALMCS" name="the good place eleanor and janet.jpg" alt="Janet and Eleanor have one last margarita on The Good Place" src="https://cdn.mos.cms.futurecdn.net/4A8HrE2V7kiHkJoNXALMCS.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="the-good-place">The Good Place</h2><p>This one surprised me when I found out, but <em>The Good Place </em>and <a href="https://www.cinemablend.com/television/2490795/the-good-place-what-the-cast-members-are-doing-next"><u><em>The Good Place </em></u><u>cast</u></a> have never won an Emmy award. The show was nominated for 14, including Outstanding Comedy Series, but aside from that, it has never actually won an award. Considering the love this show got, that&apos;s very shocking – almost as much as the twist in Season 1. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="ja8LBpnEGj7FTjABf9Q2kK" name="4a9320a141de6f3d780cd67557fd62cb (1).jpg" alt="Pedro Pascal in Narcos." src="https://cdn.mos.cms.futurecdn.net/ja8LBpnEGj7FTjABf9Q2kK.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="narcos">Narcos</h2><p><em>Narcos </em>was one of those crime drama TV shows that took the world by storm and has only gained more popularity over the last several years, especially with Pedro Pascal&apos;s rise to fame. But the series, which told the story of Pablo Escobar, was only ever nominated for Creative Arts Emmy Awards, and never for Outstanding Drama. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="hANQ4t5kcaCx4BJ9Zyqfzn" name="chappelle's show.png" alt="Some of the stars of Chappelle's Show." src="https://cdn.mos.cms.futurecdn.net/hANQ4t5kcaCx4BJ9Zyqfzn.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Comedy Central)</span></figcaption></figure><h2 id="chappelle-apos-s-show">Chappelle&apos;s Show</h2><p>Dave Chappelle is hands down one of the most influential voices in comedy and sketch television. <em>Chappelle&apos;s Show </em>is an excellent example of that, showcasing the comedian in some of the funniest sketches of the 21st century. However, the series was never nominated for Outstanding Comedy. It was, however, nominated for Outstanding Variety, Music or Comedy Series but didn&apos;t win. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="cr9Pwb2EjzNUVQ4KpYH3nb" name="KALEY CUOCO FLIGHT ATTENDANT2.png" alt="kaley cuoco the flight attendant season 1 hbo max screenshot" src="https://cdn.mos.cms.futurecdn.net/cr9Pwb2EjzNUVQ4KpYH3nb.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Max)</span></figcaption></figure><h2 id="the-flight-attendant-xa0">The Flight Attendant </h2><p>Kaley Cuoco is known for her role in the <a href="https://www.cinemablend.com/television/2493771/what-the-big-bang-theory-cast-is-doing-now"><u><em>Big Bang Theory </em></u><u>cast</u></a>, but it&apos;s a sin that people don&apos;t talk about her incredible performance in <em>The Flight Attendant </em>more<em>. </em>And while she and the show were nominated for Outstanding Comedy Series, it never won. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="i7EjQUEoADubnh695pQpsd" name="Full_Daredevil_Suit.jpg" alt="Costumed Daredevil in Netflix series" src="https://cdn.mos.cms.futurecdn.net/i7EjQUEoADubnh695pQpsd.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="daredevil">Daredevil</h2><p><em>Daredevil </em>was one of the best Marvel TV shows on Netflix, lasting for three seasons and telling authentic superhero stories that didn&apos;t seem as intense as aliens invading from the galaxy. Instead, it was a much more grounded show with excellent battle sequences. But despite its popularity, <em>Daredevil </em>was never nominated for Outstanding Drama Series. Maybe <a href="https://www.cinemablend.com/superheroes/marvel-cinematic-universe/daredevil-born-again-quick-things-we-know-about-the-marvel-series"><u><em>Daredevil: Born Again</em></u></a> will earn that privilege – only time will tell. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="LdTdx9BxiS82atSnMj9ix5" name="Shamless TV Recommendations-9.jpg" alt="Ed O'Neill, Katey Sagal, Christina Applegate, and David Faustino in Married...With Children" src="https://cdn.mos.cms.futurecdn.net/LdTdx9BxiS82atSnMj9ix5.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Fox)</span></figcaption></figure><h2 id="married-x2026-with-children">Married…With Children</h2><p><em>Married…with Children </em>was one of the best sitcoms of the late 1980s to 1990s, lasting <em>ten years </em>and eleven seasons, and it brought up one of the best-known names in comedic television, Ed O&apos;Neill. But this series, despite its long run, never won a <em>single </em>Emmy Award. Talk about the definition of snub. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="XtAPgM4jfBGzDr2diWVFg9" name="Matilda Lawler 2.jpg" alt="Matilda Lawler in Station Eleven." src="https://cdn.mos.cms.futurecdn.net/XtAPgM4jfBGzDr2diWVFg9.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Max)</span></figcaption></figure><h2 id="station-eleven">Station Eleven</h2><p><em>Station Eleven</em> was a miniseries that came out of Max (previously HBO Max), an adaptation of the novel of the same name by Emily St. John Mandel, and was one of the best post-apocalyptic TV shows out there. However, while the miniseries received praise, it was not nominated for Outstanding Limited or Anthology Series.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="qpUzcqgyJjTaoC5FWMEkcJ" name="Wanda Maximoff in Scarlet Witch Halloween costume.jpeg" alt="Elizabeth Olsen's Wanda Maximoff in Scarlet Witch Halloween costume" src="https://cdn.mos.cms.futurecdn.net/qpUzcqgyJjTaoC5FWMEkcJ.jpeg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Marvel Studios)</span></figcaption></figure><h2 id="wandavision">WandaVision</h2><p>There was a rumor that <em>WandaVision </em>would be a multi-season series, but it was put into the Emmys as Outstanding Limited or Anthology Series. Of all the <a href="https://www.cinemablend.com/superheroes/marvel-cinematic-universe/ranking-all-the-disney-mcu-shows-so-far-including-hawkeye"><u>MCU shows on Disney+</u></a>, the show was a huge hit but didn&apos;t win at the Emmys. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="4b3uG2HNveAwRDfQuoZK3D" name="The Leftovers.jpg" alt="Carrie Coon on The Leftovers" src="https://cdn.mos.cms.futurecdn.net/4b3uG2HNveAwRDfQuoZK3D.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: HBO)</span></figcaption></figure><h2 id="the-leftovers">The Leftovers</h2><p><em>The Leftovers </em>was an excellent supernatural series that showed what would happen when 2% of the world&apos;s population suddenly vanished without a trace. The series was popular and featured a fascinating story. But the show was never nominated for Outstanding Drama Series. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="9QbWo3rNLhsdjoMkcpdJQo" name="matthew-rhys_0.jpg" alt="Matthew Rhys as Perry Mason" src="https://cdn.mos.cms.futurecdn.net/9QbWo3rNLhsdjoMkcpdJQo.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: HBO)</span></figcaption></figure><h2 id="perry-mason">Perry Mason</h2><p><em>Perry Mason </em>is an HBO series people adored, but it didn&apos;t live as long as it should have, because it was <a href="https://www.cinemablend.com/television/hbo-cancels-perry-mason-following-max-rebranding-and-season-2s-cliffhanger-is-now-a-finale">canceled by Max after Season 2</a>. On top of that sad news, it hasn&apos;t been nominated for Outstanding Drama at all. The only people who have received praise are Matthew Rhys and John Lithgow, both of whom have only been nominated and not won.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="geCNLHbMtnqSPmiE3cSDtj" name="kirk5.jpg" alt="William Shatner on Star Trek" src="https://cdn.mos.cms.futurecdn.net/geCNLHbMtnqSPmiE3cSDtj.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Paramount+)</span></figcaption></figure><h2 id="star-trek">Star Trek</h2><p>While the <em>Star Trek </em>franchise has gone on for <em>many </em>years, the original <em>Star Trek</em> series (the one that pioneered and started it all) was never nominated for a <em>single </em>Emmy Award. This show, which meant so much to so many people, didn&apos;t even get to compete in this prestigious awards competition. But no matter – we&apos;ll always live long and prosper without an Emmy win. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="awoSSouFS8MPEeQudwsbXE" name="gina jane.jpg" alt="Gina Rodriguez on Jane the Virgin" src="https://cdn.mos.cms.futurecdn.net/awoSSouFS8MPEeQudwsbXE.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: The CW)</span></figcaption></figure><h2 id="jane-the-virgin">Jane The Virgin</h2><p>I know it&apos;s rare for some of <a href="https://www.cinemablend.com/television/2572614/the-best-cw-shows-that-arent-arrowverse-series-to-stream-right-now"><u>the best CW shows</u></a> to get nominated for Primetime Emmys, but <em>Jane the Virgin </em>should have been a contender. The series features an original idea, bold storytelling, and the impressive <a href="https://www.cinemablend.com/television/2571528/jane-the-virgin-cast-what-the-actors-are-doing-now"><em>Jane the Virgin </em>cast</a>. And yet, the Emmys never gave it the praise it deserved. In fact, only the <em>narrator </em>was nominated. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="wWYZmVt2NBGBw9Yafomxtd" name="bojack-horseman-season-5-1569610502396.png" alt="BoJack in BoJack Horseman" src="https://cdn.mos.cms.futurecdn.net/wWYZmVt2NBGBw9Yafomxtd.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="bojack-horseman">BoJack Horseman</h2><p>There are some excellent <a href="https://www.cinemablend.com/streaming-news/the-best-animated-shows-on-netflix-right-now-for-adults"><u>adult animated shows on Netflix</u></a>, and <em>BoJack Horseman </em>stands out as one of them<em>. </em>The series is a realistic telling of what it&apos;s like to fall out of the spotlight in Hollywood and what can happen to people. Despite its acclaim, the series was never nominated for Outstanding Comedy at the Emmys. It did get two nominations for Outstanding Animated Program, but it deserved Comedy. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="scBX5AdjzgnVgK7wpfQnEY" name="buffy .jpg" alt="Sarah Michelle Gellar on Buffy The Vampire Slayer" src="https://cdn.mos.cms.futurecdn.net/scBX5AdjzgnVgK7wpfQnEY.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Disney / Fox)</span></figcaption></figure><h2 id="buffy-the-vampire-slayer">Buffy The Vampire Slayer</h2><p>I could not think of a better example of a show that deserved way more Emmy love than <em>Buffy the Vampire Slayer </em>in its earlier seasons. The show, led by Sarah Michelle Gellar, is a staple in supernatural television. However, it has yet to receive a nomination for Outstanding Drama Series.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="UpUKw4AWFrCX5RfG3He7qT" name="Oz6.jpg" alt="The Oz Cast" src="https://cdn.mos.cms.futurecdn.net/UpUKw4AWFrCX5RfG3He7qT.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: HBO )</span></figcaption></figure><h2 id="oz">Oz</h2><p><em>Oz </em>is considered one of the best TV shows ever, taking place in a men&apos;s prison and following the stories of prisoners over six seasons. However, despite its reputation and impact on TV, it was never nominated for Outstanding Drama. The only actor who was nominated in the series was Charles S. Dutton for a guest appearance on the show. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="FU8WaAWfTg7QRAmirv25Wd" name="mindhunter.jpeg" alt="Jonathan Groff in Mindhunter" src="https://cdn.mos.cms.futurecdn.net/FU8WaAWfTg7QRAmirv25Wd.jpeg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="mindhunter">Mindhunter</h2><p><em>Mindhunter, </em>starring Jonathan Groff, was an excellent TV show on Netflix from director David Fincher, and everyone was sad when <a href="https://www.cinemablend.com/streaming-news/netflix-execs-told-david-fincher-why-they-wont-make-mindhunter-season-3-and-im-furious-at-almost-everyone-right-now"><u>Season 3 was confirmed never</u></a>. The series was fantastic and featured storytelling unlike any other. But despite its fresh tales and incredible acting, <em>Mindhunter </em>was never nominated for Outstanding Drama. It&apos;s such a shame. </p><p>Even more TV shows have never won these types of Emmys, but these are just some of the first that come to mind. But now, I know I need to rewatch some of these to give them the love they deserve – or have fun showing them to others—time for a binge-fest. </p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ 7 Characters Who Have Identified As Asexual In TV Shows ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/characters-who-have-identified-as-asexual-in-tv-shows</link>
                                                                            <description>
                            <![CDATA[ Seven characters who have identified as asexual in television shows. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">Nizwpd3g8xn8t6i87LedKF</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/dSnc7u6rsqvtD9XgknLQqG-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Wed, 15 Nov 2023 14:04:57 +0000</pubDate>                                                                                                                                <updated>Wed, 15 Nov 2023 14:43:23 +0000</updated>
                                                                                                                                            <category><![CDATA[Television]]></category>
                                                                                                                    <dc:creator><![CDATA[ Riley Utley ]]></dc:creator>                                                                                    <dc:source><![CDATA[ http://cdn.mos.cms.futurecdn.net/kXTLd8ja6TbGctTZCbdkce.jpg ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Riley Utley is the Weekend Editor at CinemaBlend. She has written for national publications as well as daily and alt-weekly newspapers in Spokane, Washington, Syracuse, New York and Charleston, South Carolina. She graduated with her master’s degree in arts journalism and communications from the Newhouse School at Syracuse University. Since joining the CB team she has covered numerous TV shows and movies -- including her personal favorite shows &lt;em&gt;Ted Lasso &lt;/em&gt;and &lt;em&gt;The Marvelous Mrs. Maisel&lt;/em&gt;. She also has followed and consistently written about everything from Taylor Swift to &lt;em&gt;Fire Country&lt;/em&gt;, and she&#039;s enjoyed every second of it.&amp;nbsp;&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What She&#039;s Into&lt;/strong&gt;: Riley’s range in likes is random and wide, from Marvel to musicals and from&lt;em&gt; Game of Thrones&lt;/em&gt; to the latest Netflix rom-com you can catch her watching just about anything. Her favorite movies include but are not limited to &lt;em&gt;When Harry Met Sally, Spider-Man: Into the Spider-verse, Finding Nemo&lt;/em&gt; and &lt;em&gt;The Grand Budapest Hotel&lt;/em&gt;. She loves going to the movie theater, consuming copious amounts of popcorn and logging whatever she saw on Letterboxd immediately afterward. She constantly walks around quoting &lt;em&gt;Ted Lasso, SNL&lt;/em&gt; and &lt;em&gt;Parks and Rec&lt;/em&gt;. She has been known to create the occasional PowerPoint explaining the MCU to those who don’t get it. In the non-media realm, Riley is a massive college basketball fan. She is a firm believer that the Gonzaga men’s basketball team is the best team of all time, and she is patiently waiting for the day they finally win a national championship. She grew up in Washington and loves skiing, coffee and making sure that people know she is from the state, not D.C.&amp;nbsp;&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What She&#039;s Excited About Right Now&lt;/strong&gt;: Anything Taylor Swift or Andrew Garfield does, finally seeing strong female representation in the MCU and eventually seeing Jonathan Bailey sing his heart out in &lt;em&gt;Wicked&lt;/em&gt;.&amp;nbsp;&lt;/p&gt; ]]></dc:description>
                                                                                                                                <cf:isSponsored>false</cf:isSponsored>
                <cf:hasAffiliateLinks>false</cf:hasAffiliateLinks>
                <cf:isPaid>false</cf:isPaid>
                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/dSnc7u6rsqvtD9XgknLQqG-1280-80.jpg">
                                                            <media:credit><![CDATA[Netflix]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[Isaac holding an ACE book in Heartstopper.]]></media:description>                                                            <media:text><![CDATA[Isaac holding an ACE book in Heartstopper.]]></media:text>
                                <media:title type="plain"><![CDATA[Isaac holding an ACE book in Heartstopper.]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/dSnc7u6rsqvtD9XgknLQqG-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>Over the years, LGBTQ+ representation has increased exponentially, and it’s been a delight to see. However, one identity under the LGBTQ+ umbrella that arguably isn’t as commonly represented as others in mainstream media is asexuality. As of late though, there has been a small spike in ace representation, and there are some excellent examples of asexual characters from all across TV -- from comedy to animation to superhero shows. </p><p>According to <a href="https://glaad.org/reference/terms/"><u>GLAAD’s Media Reference Guide</u></a>, asexual is defined as:</p><div><blockquote><p>An adjective used to describe a person who does not experience sexual attraction (e.g., asexual person). Sometimes shortened to 'ace.' Asexual is an umbrella term that can also include people who are demisexual, meaning a person who does experience some sexual attraction, but only in certain situations, for example, after they have formed a strong emotional or romantic connection with a partner.</p></blockquote></div><p>With that in mind, let’s take a look at a few TV shows (many of which are some of <a href="https://www.cinemablend.com/television/2564797/the-best-shows-to-binge-watch-on-netflix-right-now"><u>Netflix’s best series</u></a>) that have highlighted an asexual character. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="oPPrC42Z65qaWuczroaZSG" name="(20)helensloan-hbo_13446(1).jpg" alt="Todd Chavez eating cereal in Bojack Horseman." src="https://cdn.mos.cms.futurecdn.net/oPPrC42Z65qaWuczroaZSG.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix Production Still)</span></figcaption></figure><h2 id="todd-chavez-in-bojack-horseman-xa0">Todd Chavez In BoJack Horseman </h2><p>Not only is <em>BoJack Horseman </em>a beloved Netflix show (to the point <a href="https://www.cinemablend.com/television/2475022/hulu-reveals-its-3-favorite-netflix-shows-and-wants-netflix-to-play-along"><u>Hulu even said it was one of their favorites</u></a>), but Todd Chavez (voiced by Aaron Paul) is also considered one of the best representations of asexuality on TV. During Season 3 of the show, when a possible romantic interest asks him if he’s gay, Todd says:</p><div><blockquote><p>I’m not gay, I mean, I don’t think I am. But, I don’t think I’m straight either. I don’t know what I am. I think I might be nothing. </p></blockquote></div><p>His friend then lovingly comforts him. Then, in Season 4, Todd comes out to BoJack, and the two share a nice, and hilariously awkward, moment. As Sara Ghaleb wrote for <a href="https://www.vox.com/culture/2018/3/26/16291562/asexuality-tv-history-bojack-shadowhunters-game-of-thrones"><u>Vox</u></a>:</p><div><blockquote><p>BoJack Horseman changed asexual representation forever by devoting a multi-season arc to Todd coming to terms with his sexuality and finally feeling like he belongs.</p></blockquote></div><p>Between giving Todd a multi-season story arc to really delve into understanding his sexuality, and showing more than one asexual character in the series, <em>BoJack Horseman </em>really helped ace representation in media. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="8a3j7KMTdoQNDXQQdsdgvG" name="o sex education press image.jpg" alt="O standing behind a podium in Sex Education." src="https://cdn.mos.cms.futurecdn.net/8a3j7KMTdoQNDXQQdsdgvG.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Cr. Samuel Taylor/Netflix © 2023.)</span></figcaption></figure><h2 id="o-in-sex-education-xa0">O In Sex Education </h2><p>O is introduced in <a href="https://www.cinemablend.com/streaming-news/sex-education-season-4-quick-things-we-know-about-the-upcoming-installment"><u><em>Sex Education </em></u><u>Season 4</u></a> as Otis’ competition when he starts attending a new school. She’s a fellow sex therapist, and she gives lots of advice to the kids at her college. She’s also asexual and talks about it in the show. </p><p>After Otis forces O’s hand during a debate, she comes out as ace. Then, when they’re both stuck in an elevator, she opens up about trying to be like the other kids and feeling “so much pressure to behave a particular way.” That’s why she started learning about sex and relationships through literature. However, when she found that she was actually quite fascinated by it all and good at helping people solve their problems, her clinic became her safe place. </p><p>In the end, both Otis and O help each other out and, as a result, the viewers get a complex and nuanced asexual character.  </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="L8czeNf24MvR9ih68to3kG" name="isaac heartstopper s2.jpg" alt="Isaac in Heartstopper" src="https://cdn.mos.cms.futurecdn.net/L8czeNf24MvR9ih68to3kG.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="isaac-in-heartstopper-xa0">Isaac In Heartstopper  </h2><p>During <a href="https://www.cinemablend.com/streaming-news/heartstopper-season-2-quick-things-we-know-about-the-netflix-series"><u>Season 2 of </u><u><em>Heartstopper</em></u></a><em>, </em>one of the characters from Nick and Charlie’s core friend group goes on a journey of self-discovery when it comes to his sexuality. Throughout the season, Isaac starts to realize he’s asexual. After kissing a boy from school, he came to the conclusion that he didn’t want a romantic relationship with him. He then tells his friends it didn’t work out, and they fully accept him. He never outright says he’s asexual. However, during the season, he has a conversation with an older student about aromantic/asexual art, and he later picks up a book all about identifying as ace and <a href="https://www.cinemablend.com/interviews/heartstopper-editor-bringing-isaacs-story-animated-sequences-netflix"><u>little animated purple leaves float</u></a> around him. </p><p>Overall, <a href="https://www.cinemablend.com/streaming-news/season-2-netflix-heartstopper-takes-lgbtq-stories-incredibly-validated"><u>Isaac’s story is so validating</u></a>, and as the Netflix series moves into Season 3, it seems like fans will get to see more of his journey. Because this bookworm’s story has only just begun. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="u2y9LXjY4qdKdcgeztJc7H" name="spooner legends of tomorrow.jpg" alt="Spooner in Legends of Tomorrow." src="https://cdn.mos.cms.futurecdn.net/u2y9LXjY4qdKdcgeztJc7H.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: The CW)</span></figcaption></figure><h2 id="esperanza-apos-spooner-apos-cruz-in-legends-of-tomorrow-xa0">Esperanza &apos;Spooner&apos; Cruz In Legends of Tomorrow </h2><p>Esperanza “Spooner” Cruz, the telepathic hero in <em>Legends of Tomorrow</em>, came out as asexual in Season 7. In a short but meaningful scene, Spooner has a conversation with Zari 2.0. </p><p>Zari asks if they want to play smash, marry, kill. However, when she lists men, Spooner says she’s not into them. She then asks if she’s into women, and Spooner replies with a no again. Then, when Spooner says “I don’t really get those types of feelings for anyone,” and says maybe the aliens made her that way, Zari immediately comforts her and says: </p><div><blockquote><p>No, no, what you’re describing is totally normal. It just means maybe you’re ace. Asexual, people who identify as ace have little or no interest in sex, but many of them still want to be in relationships. </p></blockquote></div><p>That leads Spooner to respond with the following:</p><div><blockquote><p>I guess that makes me ace.</p></blockquote></div><p>It’s a sweet and educational scene that also gives Spooner the vocabulary she needs to truly express her identity. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="WAbFpcvbyQXfXYHhyXPa2H" name="raphael shadowhunters.jpg" alt="Raphael Santiago in Shadowhunters." src="https://cdn.mos.cms.futurecdn.net/WAbFpcvbyQXfXYHhyXPa2H.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Freeform)</span></figcaption></figure><h2 id="raphael-santiago-in-shadowhunters-xa0">Raphael Santiago In Shadowhunters  </h2><p>In Season 2 of <em>Shadowhunters</em>, Raphael finds himself in a relationship with Isabelle, and she asks him if he&apos;s only with her because of the Shadowhunter&apos;s blood in their system. He said he had feelings for her, however, he was “just not interested in sex.” After she felt rejected and asked if being a vampire made him feel that way, Raphael corrected her, saying he’d always had those feelings.</p><p>Later on, the author of the <em>Shadowhunter Chronicles</em>, Cassandra Clare, confirmed his sexuality was canon in both the show and books, posting:</p><div class="see-more see-more--clipped"><blockquote class="twitter-tweet hawk-ignore" data-lang="en"><p lang="en" dir="ltr">“@YazmnMolina: " @BraveRunes Raphael was bisexual, as Magnus?” Raphael was asexual.<a href="https://twitter.com/cassieclare/status/506200230615064576">August 31, 2014</a></p></blockquote><div class="see-more__filter"></div></div><p>This moment was also quite historic in terms of ace representation. Every year, GLADD releases <a href="https://issuu.com/glaad/docs/wwat_glaad_2017-2018?utm_medium=referral&utm_source=glaad.org"><u><em>Where We Are On TV</em></u><u>, and the ‘17/’18 report</u></a> was the first time asexual characters were included. In that document, Raphael Santiago from <em>Shadowhunters </em>was “the only asexual character on all of cable television.” The only other ace character counted in that report was from the streaming realm -- <em>Bojack Horseman</em>&apos;s Todd. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="5zwEuPkNjxqpRRF6vf9BZG" name="(20)helensloan-hbo_13446.jpg" alt="Varys in Game of Thrones looking up." src="https://cdn.mos.cms.futurecdn.net/5zwEuPkNjxqpRRF6vf9BZG.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Photograph by Helen Sloan/HBO)</span></figcaption></figure><h2 id="lord-varys-in-game-of-thrones">Lord Varys In Game Of Thrones</h2><p>In <em>Game of Thrones</em>, Lord Varys, who played a pivotal role as the “Master of Whispers” in Kings Landing, is a eunuch. As <a href="https://gcn.ie/9-asexual-characters/"><u>GCN </u></a>pointed out, while there are quite a few eunuchs in the show, they are sexually active. However, in Season 4, Varys explains that he really has no interest in sex or romance. During a conversation with Pedro Pascal’s Oberyn, he&apos;s asked if he’s into girls or boys, and he responds by saying “nothing.” Varys then continues, explaining:</p><div><blockquote><p>Not me. When I see what desire does to people and what it’s done to this country, I am very glad to have no part in it. Besides, the absence of desire leaves one to pursue other things.</p></blockquote></div><p>When asked what he’s pursuing, Varys simply looks at the Iron Throne and walks away. While it’s never explicitly stated that he is asexual, his explanation to Oberyn makes it quite clear, and many consider this <em>Game of Thrones </em>character to be part of the ace community. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="QV8ypyy73tAxjU9HBYhYeG" name="elijah big mouth.jpg" alt="Elijah in Big Mouth" src="https://cdn.mos.cms.futurecdn.net/QV8ypyy73tAxjU9HBYhYeG.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="elijah-in-big-mouth">Elijah In Big Mouth</h2><p>Elijah (voiced by Brian Tyree Henry) was introduced in Season 6 of <a href="https://www.cinemablend.com/television/how-big-mouth-gets-lgbtq-representation-right"><em>Big Mouth</em>, which has received acclaim for its LGBTQ+ representation</a>, and bringing in this young Black boy added an ace character into the show&apos;s diverse ensemble.  </p><p>In the series, Elijah and Missy start seeing each other, but he realizes he doesn’t have the same feelings she has. At dinner with his family, his aunt says he might be asexual, like her, and he realizes that he is indeed. Now, in regard to Season 7, EP Andrew Goldberg told <a href="https://www.metacritic.com/news/big-mouth-season-6-elijah-asexuality/"><u>Meta Critic</u></a> that they are hoping to depict “the different ways that asexuality can express itself in a person.” </p><p>Overall, asexual representation has a long way to go. However, in recent years, it’s gotten better, in great part due to characters like the seven listed above. </p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ The Best Animated Shows On Netflix Right Now For Adults ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/streaming-news/the-best-animated-shows-on-netflix-right-now-for-adults</link>
                                                                            <description>
                            <![CDATA[ If you're looking for a brilliant animated series to watch right now, check out these picks from Netflix. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">6Va72LNrAYTDvZJKsJyDdg</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/B42rfKqVJbEFMLwrY6MtDS-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Thu, 27 Oct 2022 18:40:36 +0000</pubDate>                                                                                                                                                                                                                                <category><![CDATA[Streaming News]]></category>
                                                                                                                    <dc:creator><![CDATA[ Alexandra Ramos ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/4vCq2c3J9ZiZUXQ3hPz69T.png ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Alexandra Ramos is a Content Producer at CinemaBlend. She first started off working in December 2020 as a Freelance Writer after graduating from the Pennsylvania State University with a degree in Journalism and a minor in English. She later moved over to full-time in July of 2021, and primarily works in features for movies, TV, and sometimes video games. She is also the main person who runs both our daily newsletter, The CinemaBlend Daily, and our ReelBlend newsletter that is sent out bi-weekly to patrons.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;
&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What She&#039;s Into&lt;/strong&gt;: Alex is into many things. She loves all kinds of movies except for super sappy romantic ones - with the only redeeming case being The Notebook, and is a big fantasy nerd. She’s a huge fan of the streaming shows that have been released, and loves to watch series’ like The Witcher, Shadow &amp;amp; Bone, and more. Her all-time favorite TV show has to be a solid three-way tie between Breaking Bad, Game of Thrones and Attack on Titan - she just can’t seem to pick one. Alex is also a big Marvel nerd, and will defend Scarlet Witch until her dying day. For years, she’s been an avid gamer, primarily for the PlayStation, and has become a part of the fanbase for games like The Last Of Us, God of War, Spider-Man, and more, but that won’t stop her from playing simple games like Animal Crossing, or FPS’ like Call of Duty. Alex is also a big sports fan and considers herself a couchside coach because she will threaten to throw stuff at her TV if Penn State or the NY Giants are losing (which is often), usually with pizza in her hands.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What She&#039;s Excited About Right Now&lt;/strong&gt;: The Boys Season 4 and its spinoff, Gen V Season 2, House of the Dragon Season 2, The Bear Season 4, Fallout, and Bridgerton Season 3 because I&#039;m missing my steamy romance.&amp;nbsp;&lt;/p&gt; ]]></dc:description>
                                                                                                                                <cf:isSponsored>false</cf:isSponsored>
                <cf:hasAffiliateLinks>false</cf:hasAffiliateLinks>
                <cf:isPaid>false</cf:isPaid>
                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/B42rfKqVJbEFMLwrY6MtDS-1280-80.jpg">
                                                            <media:credit><![CDATA[Netflix]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[Jinx in Arcane.]]></media:description>                                                            <media:text><![CDATA[Jinx in Arcane.]]></media:text>
                                <media:title type="plain"><![CDATA[Jinx in Arcane.]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/B42rfKqVJbEFMLwrY6MtDS-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>While I do enjoy watching<a href="https://www.cinemablend.com/television/2571467/the-best-fantasy-shows-to-stream-right-now"> <u>the best fantasy shows</u></a> like <em>House of the Dragon, </em>or even some of the latest Netflix originals, <em>The Watcher, </em>sometimes I just need a break from live-action TV shows. This is what leads me to this article today, featuring some of the best animated TV shows that you can watch right now - most of which adults can enjoy. </p><p>In my opinion, these are some of the<a href="https://www.cinemablend.com/television/2564797/the-best-shows-to-binge-watch-on-netflix-right-now"> <u>best shows on Netflix</u></a> to binge watch, from classics like <em>Avatar: The Last Airbender </em>to Netflix TV shows like <em>Big Mouth </em>or <em>BoJack Horseman. </em>If you’re looking for some great animated TV series to enjoy, check out some of the best animated shows on Netflix. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="rUakC7J7qquNoLacYJ39Ad" name="Screen Shot 2022-06-06 at 11.11.53 PM.png" alt="Will Arnett and Kristen Schaal's BoJack Horseman characters" src="https://cdn.mos.cms.futurecdn.net/rUakC7J7qquNoLacYJ39Ad.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="bojack-horseman-xa0">BoJack Horseman </h2><p>In this Netflix original series, <em>BoJack Horseman </em>follows the titular character, a former star in Hollywood who has since faded into obscurity. Now, he plans to make a comeback by releasing his tell-all autobiography, with the help of a ghost writer by his side. </p><p><em>BoJack Horseman </em>is one of the best Netflix originals out there. Its characters are extremely compelling, from the depressing story of BoJack to the stories of his friends around him, to how he tries to accept himself for who he is. It also tackles themes of self-loathing, eating disorders, depression, alcoholism, and so much more, mixed in with some funny comedy along the way. It’s truly a show that deserved all the praise that it got in its run, and you should definitely check it out if you’ve never done so before. </p><p><a href="https://www.netflix.com/title/70300800"><u><strong>Stream BoJack Horseman on Netflix. </strong></u></a></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="TBJ6pnTPdAnxJzJDRr5zUN" name="disenchantment.jpg" alt="Luci, Bean, and Elfo on Disenchantment" src="https://cdn.mos.cms.futurecdn.net/TBJ6pnTPdAnxJzJDRr5zUN.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="disenchantment-xa0">Disenchantment  </h2><p>From the creator of <em>The Simpsons,</em><a href="https://www.cinemablend.com/television/2475487/the-simpsons-futurama-and-the-legendary-career-of-matt-groening"> Matt Groening</a>, this much newer cartoon is the fantasy series <em>Disenchantment. </em>In this Netflix original, set in the medieval European kingdom of Dreamland, we follow Bean, a rebellious, alcoholic, adventurous princess with a heart of gold, and her companion, Elfo, along her crazy adventures. </p><p>I think what I enjoy the most about <em>Disenchantment </em>is, honestly, the animation. With the same animation style as <em>The Simpsons, </em>the Netflix original takes it up a couple of levels, offering some truly beautifully animated scenes mixed in with some hilarious takes on fantasy shows and movies, often parodying them. Bean is also a great character to follow, from her selfless deeds to her adventurous acts, she absolutely will never bore you. With four seasons to watch, it’s truly a fun time. </p><p><a href="https://www.netflix.com/title/80095697"><strong>Stream Disenchantment on Netflix. </strong></a></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="AMXGe7Ha8fH58m7HSnzPUf" name="conniebigmouth710 (1).jpg" alt="Maya Rudolph's character (left) in Big Mouth." src="https://cdn.mos.cms.futurecdn.net/AMXGe7Ha8fH58m7HSnzPUf.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="big-mouth">Big Mouth</h2><p>Another Netflix original, <em>Big Mouth, </em>created by Andrew Goldberg and Nick Kroll, centers on teens that are being raised in suburban New York, exploring puberty while embracing an openness about the human body and sex that’s not often talked about when it comes to younger teenagers. </p><p>Personally, I’ve never been the biggest fan of <em>Big Mouth, </em>just because the animation style isn’t my favorite. However, that doesn’t change the fact that the show is still great in many ways, from its openness about sexuality, enjoyable characters with entertaining storylines, and its star-studded cast. Maya Rudolph, John Mulaney, and many other stars voice some of the characters, creating a truly hilarious yet touching TV show, and with a seventh season on the way, now is the time to watch it.</p><p><a href="https://www.netflix.com/title/80117038"><u><strong>Stream Big Mouth on Netflix. </strong></u></a></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="JSgXnEpFXXogftdZwgEoA6" name="human.jpg" alt="Human Resources cast" src="https://cdn.mos.cms.futurecdn.net/JSgXnEpFXXogftdZwgEoA6.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="human-resources">Human Resources</h2><p>In a spinoff of <em>Big Mouth, </em>now we take a look at <em>Human Resources. </em>This show actually follows the Hormone Monsters that we meet in <em>Big Mouth, </em>specifically in their workplace and how they learn to become the characters that we all know and love them to be in the original series. </p><p>I want you to think<em> The Office, </em>but animated, and way dirtier and raunchier and that’s what <em>Human Resources </em>is like. Many of the voice cast from <em>Big Mouth </em>also have parts in the spinoff, as well as new cast members <a href="https://www.cinemablend.com/streaming-news/keke-palmer-movies-and-shows-to-watch-if-you-like-the-actress"><u>such as Keke Palmer</u></a>, Randall Park, Aidy Bryant and more. It’s a fun addition to the <em>Big Mouth </em>universe and one I think any fan of the original series should check out. </p><p><a href="https://www.netflix.com/title/81092963"><u><strong>Stream Human Resources on Netflix. </strong></u></a></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="Dq2LyxYpVu8CXh8wwxFVJn" name="MV5BZjU4NzdjOTAtYjMyMS00OGQ1LWE4ZDYtZTZmYTc3NWNhOTY1XkEyXkFqcGdeQWFybm8@._V1_ (1).jpg" alt="Some of the robots in Love, Death and Robot." src="https://cdn.mos.cms.futurecdn.net/Dq2LyxYpVu8CXh8wwxFVJn.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="love-death-amp-robots-xa0">Love, Death & Robots </h2><p>In this animated series, <em>Love, Death & Robots </em>consists of several stand-alone episodes, all under 20 minutes long, produced by different casts and crews, with each episode having a thematic connection to the episode’s title. </p><p>I’m sure reading that probably made your head spin a little. It doesn&apos;t seem like there’s a plot in <em>Love, Death & Robots, </em>and that’s because there really isn’t one. What makes <em>Love, Death & Robots </em>so good is that every episode is different, and you can really tell with the different creatives that they bring in. But, each episode provides a<a href="https://www.cinemablend.com/television/2468673/netflix-denies-changing-love-death-and-robots-episode-order-based-on-sexual-identity"> new enriching story</a> that will captivate you from beginning to end, having some sort of connection to the title. Will the episode be about love? Or death? Or robots? All three, or some other combination? There are so many questions - all of which will be answered.</p><p><a href="https://www.netflix.com/title/80174608"><strong>Stream Love, Death & Robots on Netflix. </strong></a></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="P6SShCS3qaxyCQcJuUEJ4A" name="AAAABSVcwNx287eve6LG0tENTvbkFSmsksUkovr8QEjaEYPiw55UKfYHC_cICStQOlyYtW_4_LtIF2kV17uWiRYOUFqrfBaz.jpg" alt="Some of the amazing animation in The Midnight Gospel." src="https://cdn.mos.cms.futurecdn.net/P6SShCS3qaxyCQcJuUEJ4A.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="the-midnight-gospel-xa0">The Midnight Gospel </h2><p>Created by <em>Adventure Time </em>creator, Duncan Trussell, <em>The Midnight Gospel </em>is set in a world known as the Chromatic Ribbon, with a space caster known as Clancy Gilroy who owns an unlicensed multiverse simulator. Through that, he travels into bizarre worlds on the brink of disaster, interviewing residents for his space cast. </p><p>When I was younger, <em>Adventure Time </em>was one of my favorite shows to enjoy. Watching <em>The Midnight Gospel </em>feels like that, except for older people. The interviews that Duncan uses are actually derived from interviews on his real-life podcast, called <em>The Duncan Trussell Family Hour, </em>and features really cool animation style with some actually insightful interviews that will surprise you by coming from an animated series.</p><p><a href="https://www.netflix.com/title/80987903"><u><strong>Stream The Midnight Gospel on Netflix.</strong></u></a></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="zWojUGSJxLvxsa8cZLR3ZT" name="maxresdefault - 2022-08-15T105125.226 (1).jpg" alt="Aang and Firelord Ozai in Avatar: The Last Airbender." src="https://cdn.mos.cms.futurecdn.net/zWojUGSJxLvxsa8cZLR3ZT.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Nickelodeon)</span></figcaption></figure><h2 id="avatar-the-last-airbender">Avatar: The Last Airbender</h2><p><em>Avatar: The Last Airbender </em>is all about Aang, the Avatar. Once there were four nations who lived in harmony, but when one of them wants to take over the world, it’s up to the Avatar to somehow bring the world back to peace. However, Aang is young, and still needs to learn the other three elements of water, fire, and earth in order to defeat the Fire Lord from taking over the world. </p><p>Oh, <em>Avatar. </em>I love this show with such a deep passion. While it’s technically catered to children, adults can love this show for the values it teaches. <a href="https://www.cinemablend.com/television/2571990/avatar-the-last-airbender-relevant-rewarding-older-audiences-jack-desena"> <u><em>Avatar: The Last Airbender </em></u><u>grew even more popular in 2020</u></a> when the series came to Netflix, and more so when it was announced a<a href="https://www.cinemablend.com/television/2572101/netflix-live-action-avatar-the-last-airbender-tv-show-quick-things-we-know-including-its-focus-on-poc-casting"> <u>new live-action</u></a> of the series would come out on the platform. But, please, trust me when I say this -<a href="https://www.cinemablend.com/television/2560939/avatar-the-last-airbender-why-its-time-to-give-this-amazing-show-a-chance"> <u>watch </u><u><em>Avatar: The Last Airbender</em></u></a><em>. </em>It’s such an amazing show, from its animation style to its themes to its characters, there’s so much I love about this show, and so much you can love as well. And if you end up really liking it, be sure to <a href="https://www.cinemablend.com/television/2573379/the-legend-of-korra-things-i-love-about-the-show-even-more-when-rewatching"><u>check out its sequel, </u><u><em>The Legend of Korra</em></u></a><em>. </em></p><p><a href="https://www.netflix.com/title/70142405"><u><strong>Stream Avatar: The Last Airbender on Netflix. </strong></u></a></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="hnE6ZACZsBAWQu4KqM7RU9" name="castlevania-spinoff-trevor-belmont-son-daughter (2).jpg" alt="Trevor in Castlevania." src="https://cdn.mos.cms.futurecdn.net/hnE6ZACZsBAWQu4KqM7RU9.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="castlevania-xa0">Castlevania  </h2><p>In this Netflix original, <em>Castlevania </em>follows Trevor Belmont and his allies as they defend the nation of Wallachia from Dracula and his minions, trying to protect them from a world of utter darkness. </p><p><em>Castlevania </em>often reminds me of many anime series with its animation style, sort of how <em>Avatar: The Last Airbender </em>did it, but <em>Castlevania </em>is certainly more for adults. It’s a dark fantasy series with plenty of blood and violent moments, but it’s still incredibly stunning, influenced by gorgeous Japanese animation, and has a story that will entertain anyone who’s into fantasy or vampires, or both. </p><p><a href="https://www.netflix.com/title/80095241"><u><strong>Stream Castlevania on Netflix. </strong></u></a></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="7n27cJKh7hiYxY8rjEtAZK" name="Jinx-at-the-end-of-Arcane-Season-1-e1637431976756 (1).jpg" alt="Jinx in Arcane." src="https://cdn.mos.cms.futurecdn.net/7n27cJKh7hiYxY8rjEtAZK.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="arcane-xa0">Arcane </h2><p>This show <em>ruined me </em>– in a good way. </p><p>Based on the popular game, <em>League of Legends, </em>the Netflix original series, <em>Arcane, </em>follows some of the most iconic champions of the original game, taking place in the land Piltover and Zaun, two very different cities, and focusing on the bond between sisters Vi and Powder, and how one moment in their younger years changes the course of their lives forever. </p><p><a href="https://www.cinemablend.com/streaming-news/arcane-10-other-shows-to-watch-if-you-like-the-league-of-legends-series"><u><em>Arcane </em></u><u>is one of those shows</u></a> that when it first came out, it was a little under the radar, but has only continued to grow in popularity. Not only was it nominated for multiple Emmy awards (winning some of them), it’s already <a href="https://deadline.com/2021/11/arcane-renewed-season-2-netflix-1234878165/"><u>receiving a Season 2.</u></a> You’ll be blown away by the amazing animation, the creative fight style, and the characters that you can’t help but love. Jinx has become <a href="https://www.cinemablend.com/streaming-news/arcane-why-jinx-is-one-of-the-best-written-villains-on-tv-right-now"><u>one of my favorite animated villains</u></a> <em>ever. </em>It’s seriously such a great show. </p><p>Don’t let the fact that it’s attached to a video game stop you – you can totally watch this without ever having played <em>LoL. </em>It even has a <a href="https://www.cinemablend.com/streaming-news/3-recent-netflix-original-series-earned-perfect-scores-on-rotten-tomatoes"><u><em>rare </em></u><u>perfect score on Rotten Tomatoes</u></a>, as well as a <em>super high </em>audience score. That’s how you <em>know </em>it’s good. </p><p><a href="https://www.netflix.com/title/81435684"><u><strong>Stream Arcane on Netflix. </strong></u></a></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.33%;"><img id="ukPHrX3dYHZoK79oamAiXj" name="9ae55d8b4735942b7c0114a6aa5bf9f019efac310e709c9e6b11403360e38fc5._SX1080_ (1).jpg" alt="The main character of Death Note." src="https://cdn.mos.cms.futurecdn.net/ukPHrX3dYHZoK79oamAiXj.jpg" mos="" align="middle" fullscreen="" width="1280" height="721" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Crunchyroll)</span></figcaption></figure><h2 id="death-note">Death Note</h2><p>I can’t have an adult animated series list without mentioning <em>Death Note. </em>In this classic anime from the early 2000s, <em>Death Note </em>tells the story of a young man, Light, who ends up finding the titular notebook, where if you write someone’s name in it, death comes to them quite quickly. However, with that sort of power, anyone can lose themselves to madness. </p><p><em>Death Note </em>is one of those anime that I think everyone has heard about at this point. If you’ve never seen anime, it’s a <a href="https://www.cinemablend.com/television/new-to-anime-the-best-shows-to-watch-when-youre-just-starting-out"><u>great show to start out on</u></a>, and features a story that will truly captivate you from beginning to end. Just ignore the live-action remakes of it because those just aren’t good. Stick to the animated series because it’s outstanding. </p><p><a href="https://www.netflix.com/title/70204970"><u><strong>Stream Death Note on Netflix. </strong></u></a></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="mfsRyPaDLQ3xwoFf6zBfuD" name="Screenshot (569).png" alt="Tiffany Haddish's character in Tuca & Bertie." src="https://cdn.mos.cms.futurecdn.net/mfsRyPaDLQ3xwoFf6zBfuD.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix/Adult Swim)</span></figcaption></figure><h2 id="tuca-and-bertie">Tuca And Bertie</h2><p>If you want a classic roommate show, check out <em>Tuca and Bertie. </em>In this show featuring the voice <a href="https://www.cinemablend.com/streaming-news/the-best-tiffany-haddish-movies-and-tv-shows-and-how-to-watch-them"><u>talents of Tiffany Haddish</u></a> and Ali Wong, two bird-women are living in an apartment together in their thirties, trying to navigate both their professional and personal lives, relationships and messiness involved. </p><p>While <em>Tuca and Bertie </em>isn’t a new concept – as we have gotten conflicting odd couple roommate stories since the dawn of television – what really drives this series is the voice-acting of both Haddish and Wong because they truly win you over. They create some hilarious moments that have me holding my side laughing for hours on end and it’s something I need more people to see. Bird Town is a metropolis where anything is possible and these two certainly prove that. </p><p><a href="https://www.netflix.com/title/80198137"><u><strong>Stream Tuca and Bertie on Netflix.</strong></u></a></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="EFefWpTpKmvpv8MZCvRkFM" name="1033195-bill-burr-talks-f-family (1).jpg" alt="The main family in F is for Family." src="https://cdn.mos.cms.futurecdn.net/EFefWpTpKmvpv8MZCvRkFM.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="f-is-for-family-xa0">F Is For Family </h2><p>Last but not least, we take a look at <em>F is for Family. </em>Created by Bill Burr, <em>F is For Family </em>follows a dysfunctional, suburban Irish-American family, set in the fictional town of Rustvale, Pennsylvania, in the 1970s. </p><p>While a lot of these other cartoons might have serious themes or beautiful stories,  <em>F is for Family </em>is all about its comedy. It’s hilarious, and its four seasons (soon to be five) is proof of that. Bill Burr voices Frank, the patriarch of the family, alongside a great cast including Laura Dern, Justin Long, and many others. It’s seriously funny and you’ll be holding your sides from laughing so much. Give it a shot.</p><p><a href="https://www.netflix.com/title/80028732"><u><strong>Stream F is for Family on Netflix. </strong></u></a></p><p>There are so many fantastic animated TV shows to watch, so truly, you’ll never go wrong with a bad pick. If you’re looking for something awesome to stream, check out any of these. You won’t regret it.</p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ Olivia Wilde: What To Watch If You Like The Actor And Director ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/streaming-news/olivia-wilde-what-to-watch-if-you-like-the-actor-and-director</link>
                                                                            <description>
                            <![CDATA[ Olivia Wilde has a number of wonderful performances in movies and TV shows under her talented belt. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">e4EBEoP8np3qSxoAgnp5wc</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/wxHaVgyVCfEY8NG9MoZpDK-1280-80.png" type="image/png" length="0"></enclosure>
                                                                        <pubDate>Thu, 14 Jul 2022 13:04:04 +0000</pubDate>                                                                                                                                                                                                                                <category><![CDATA[Streaming News]]></category>
                                                                                                                    <dc:creator><![CDATA[ Adrienne Jones ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/ttBJtAZ7vqCe9Tp4BQiALo.png ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Adrienne Jones is a Senior Content Producer at CinemaBlend, and started at the site in the fall of 2015. In addition to writing and editing stories on a variety of different topics, she also spends her work days trying to find new ways to write about the many romantic entanglements that fictional characters find themselves in on TV shows. She graduated from Mizzou with a degree in Photojournalism.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What She&#039;s Into&lt;/strong&gt;: Adrienne will maintain until her dying day (and probably well after that, if possible) that 9 to 5 is one of the best movies ever made, though she also holds a special place in her heart for Auntie Mame, Office Space, and Bridesmaids. This may make it sound like her life and entertainment choices are only giggle-focused (not totally untrue), but she also enjoys warm-hearted dramadies (Gilmore Girls, Lovesick), creepy stuff (The X-Files, Evil), sci-fi/fantasy (most Star Treks, The Witcher), romantic shows (Bridgerton, Sweet Magnolias, Outlander), and the occasional drama (The Wire, Vikings: Valhalla). Adrienne likes cooking, but also ordering delivery so that strangers can be forced to bring her food, and believes that most days are incomplete without chocolate, reading, and staring out the window to see if any wild animals are engaging in shenanigans.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What She&#039;s Excited About Right Now&lt;/strong&gt;: Fall weather and raccoons that only come out at night!&lt;/p&gt; ]]></dc:description>
                                                                                                                                <cf:isSponsored>false</cf:isSponsored>
                <cf:hasAffiliateLinks>false</cf:hasAffiliateLinks>
                <cf:isPaid>false</cf:isPaid>
                                                                                                                                <media:content type="image/png" url="https://cdn.mos.cms.futurecdn.net/wxHaVgyVCfEY8NG9MoZpDK-1280-80.png">
                                                            <media:credit><![CDATA[Disney]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[olivia wilde protecting garrett hedlund in tron: legacy]]></media:description>                                                            <media:text><![CDATA[olivia wilde protecting garrett hedlund in tron: legacy]]></media:text>
                                <media:title type="plain"><![CDATA[olivia wilde protecting garrett hedlund in tron: legacy]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/wxHaVgyVCfEY8NG9MoZpDK-1280-80.png" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>Olivia Wilde has made quite the name for herself since her breakout role as night club manager Alex Kelly on Season 2 of <em>The O.C.</em> That mid-’00s recurring role helped launch Wilde’s career on the small and big screen, where the actress has racked up credits in dozens of well-known movies and television shows, co-starred opposite beloved stars such as Hugh Laurie, Harrison Ford, Oscar Isaac, Anna Kendrick, Chris Pine, and many more. </p><p>In fact, <a href="https://www.cinemablend.com/movies/how-olivia-wilde-ended-up-actually-appearing-opposite-harry-styles-and-co-in-her-new-movie-dont-worry-darling"><u>Wilde will be reuniting with Pine in her return to movie theaters</u></a> in late September, when her second directorial effort, <a href="https://www.cinemablend.com/movies/dont-worry-darling-quick-things-we-know-about-olivia-wildes-movie"><u><em>Don’t Worry Darling</em></u><u>, makes its debut</u></a> as part of the 2022 <a href="https://www.cinemablend.com/news/2569630/2022-new-movie-release-dates-full-schedule-of-all-the-upcoming-movies"><u>new movie releases</u></a>. With the actor and director now firmly ensconced both in front of and behind the camera, it seemed like a good time to give those who love watching Wilde’s work a handy list of the movies and series they should check out when they want to see the star in action. Now, let’s get to what you should watch if you like Olivia Wilde!</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="oeBpYRGfnCUCG2hbH7jvyY" name="house.png" alt="13 and kutner in house" src="https://cdn.mos.cms.futurecdn.net/oeBpYRGfnCUCG2hbH7jvyY.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Fox)</span></figcaption></figure><h2 id="house-peacock">House (Peacock)</h2><p>The misanthropic Dr. Gregory House (Hugh Laurie) leads a team of medical diagnosticians at a teaching hospital in New Jersey, where he frequently clashes with them, his bosses, and sometimes his patients because of his unconventional methods and rude attitude. </p><p>Olivia Wilde joined the <a href="https://www.cinemablend.com/television/2495999/what-the-house-cast-is-doing-now"><u><em>House</em></u><u> cast</u></a> in Season 2 as a new member of the eponymous doctor’s team, Dr. Remy “Thirteen” Hadley, and it would be fairly accurate to say that this is the part that catapulted Wilde to stardom. Her Thirteen, as the character was most widely known, was rather mysterious and extremely slow to reveal any personal details about herself, but was also unfailingly compassionate and brave (or, sometimes, reckless) in the face of her own serious illness. This is definitely a great place to start to get an early look at what Wilde is capable of on screen.</p><p><a href="https://www.peacocktv.com/watch/asset/tv/house/5237177968815004112?orig_ref=https://www.google.com/"><u><strong>Stream House on Peacock</strong></u></a><strong>.<br></strong><a href="https://www.amazon.com/Pilot/dp/B000WCT7M8/ref=sr_1_1?crid=223IF3NMDEJSW&keywords=house&qid=1656198193&s=movies-tv&sprefix=house%2Cmovies-tv%2C184&sr=1-1"><u><strong>Buy House on Amazon</strong></u></a><strong>.</strong></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="MpSKysZNUeSyrFQiabiKq" name="drinking buddies.png" alt="olivia wilde in drinking buddies" src="https://cdn.mos.cms.futurecdn.net/MpSKysZNUeSyrFQiabiKq.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Magnolia Pictures)</span></figcaption></figure><h2 id="drinking-buddies-hulu">Drinking Buddies (Hulu)</h2><p>Luke (Jake Johnson) and Kate (Olivia Wilde) are co-workers and best buddies who work at a small Chicago brewery and happen to have great chemistry that could easily turn into something besides friendship, except they are both seeing other people.</p><p>It would be fair to say that Olivia Wilde has honed a cool chick vibe over the course of her career (mostly fueled by playing a number of characters who are really good at what they do and totally unapologetic about it), and <em>Drinking Buddies</em> has certainly added to that allure. Wilde does a great job playing someone whose professional life is great, but has a bit of turmoil when it comes to dealing with her feelings for her friend, as well as handling his feelings for her.</p><p><a href="https://www.hulu.com/movie/drinking-buddies-ecc74afc-2e14-4e7e-839c-789954619f8f"><u><strong>Stream Drinking Buddies on Hulu</strong></u></a><strong>.<br></strong><a href="https://www.amazon.com/Drinking-Buddies-Olivia-Wilde/dp/B00G3FFVQY/ref=sr_1_1?crid=4F7U2D0VE96W&keywords=drinking+buddies&qid=1656198144&s=instant-video&sprefix=drinking+buddies%2Cinstant-video%2C210&sr=1-1"><u><strong>Rent/Buy Drinking Buddies on Amazon</strong></u></a><strong>.</strong></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="8oHSPMNzDqo4jKKqByz99H" name="rush.png" alt="olivia wilde in rush" src="https://cdn.mos.cms.futurecdn.net/8oHSPMNzDqo4jKKqByz99H.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Universal Pictures)</span></figcaption></figure><h2 id="rush-netflix">Rush (Netflix)</h2><p>Formula One race car drivers James Hunt (Chris Hemsworth) and Niki Lauda (Daniel Brühl) begin a years-long rivalry in 1970, which eventually spurs each man to compete at higher and higher levels amid a number of personal difficulties, both large and small. </p><p><em>Rush</em> is a biographical drama that covers the real-life feud between Hunt and Lauda, which features Olivia Wilde in a relatively small part as Hunt’s wife, model Suzy Miller. While Wilde is not on screen for long, it doesn’t take long for her to make Suzy much more than a fashionable side character, as we can see clearly how tough and uncompromising she was when dealing with her husband once professional setbacks began to sour their relationship.</p><p><a href="https://www.netflix.com/title/70253165"><u><strong>Stream Rush on Netflix</strong></u></a><strong>.<br></strong><a href="https://www.amazon.com/Rush-Chris-Hemsworth/dp/B00H967074/ref=sr_1_2?crid=2OCG75A92E8T2&keywords=rush+movie&qid=1657560544&s=instant-video&sprefix=rush+movie%2Cinstant-video%2C1636&sr=1-2"><u><strong>Rent/buy Rush on Amazon</strong></u></a><strong>.</strong></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="vvKYmR8m3Z6DnUKpdmyCnV" name="tron1.png" alt="olivia wilde in tron: legacy" src="https://cdn.mos.cms.futurecdn.net/vvKYmR8m3Z6DnUKpdmyCnV.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Disney)</span></figcaption></figure><h2 id="tron-legacy-disney">Tron: Legacy (Disney+)</h2><p>Decades after video game developer Kevin Flynn (Jeff Bridges) goes missing, his son, Sam (Garrett Hedlund) ends up lost in the same virtual reality that his father created and was trapped in all of those years ago.</p><p><em>Tron: Legacy</em> saw the cult hit, <em>Tron</em>, finally get the sequel fans were hoping for after almost 30 years. The movie is a thrilling addition to the lore, and that’s thanks in a large part to Olivia Wilde’s badass role as the virtual reality warrior Quorra, who helps Sam and Kevin fight for survival in the dangerous world.</p><p><a href="https://www.disneyplus.com/movies/tron-legacy/blTc6WOlDg44"><u><strong>Stream Tron: Legacy on Disney+</strong></u></a><strong>.<br></strong><a href="https://www.amazon.com/Tron-Legacy-Jeff-Bridges/dp/B0094KT8W8/ref=sr_1_1?crid=2ZXMW8G5OHWL9&keywords=tron+legacy&qid=1656198058&s=instant-video&sprefix=tron+legacy%2Cinstant-video%2C182&sr=1-1"><u><strong>Rent/Buy Tron: Legacy on Amazon</strong></u></a><strong>.</strong></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="zFR2Cp5dKkkACyc4ntZcyk" name="the oc.png" alt="olivia wilde in the o.c." src="https://cdn.mos.cms.futurecdn.net/zFR2Cp5dKkkACyc4ntZcyk.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Fox)</span></figcaption></figure><h2 id="the-o-c-hulu">The O.C. (Hulu)</h2><p>At risk teen Ryan Atwood (Ben McKenzie) finds a saving grace in his public defender, Sandy Cohen (Peter Gallagher), who takes him home to live with his family in his wealthy Orange County, California neighborhood, where Ryan ends up embroiled in the complicated relationships there.</p><p>There’s nothing quite like a teen soap opera, and <em>The O.C.</em> started out very strong on Fox in 2003. The first season made stars out of the young and mostly unknown cast members, and it shows just how strong of a performer Olivia Wilde is that her smart, tough, and independent Alex Kelly was able to become a standout when she debuted in Season 2. If you want to see the roots of Wilde’s cool girl charm, head here.</p><p><a href="https://www.hulu.com/series/the-oc-99fb982a-a55c-4d9d-96af-5fc9b8690238"><u><strong>Stream The O.C. on Hulu</strong></u></a><strong>.<br></strong><a href="https://www.amazon.com/Pilot/dp/B001AVW600/ref=sr_1_1?crid=1MBULRLW6CWB4&keywords=the+o.c.+tv+series&qid=1656198003&s=instant-video&sprefix=the+o.c.%2Cinstant-video%2C180&sr=1-1"><u><strong>Buy The O.C. on Amazon</strong></u></a><strong>.</strong></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="CJn8CfkK7rJecqkSBXuyaE" name="coopers.png" alt="olivia wilde and jake lacy in love the coopers" src="https://cdn.mos.cms.futurecdn.net/CJn8CfkK7rJecqkSBXuyaE.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Lionsgate)</span></figcaption></figure><h2 id="love-the-coopers-rental">Love The Coopers (Rental)</h2><p>The dysfunctional Cooper family, headed up by Charlotte (Diane Keaton) and Sam (John Goodman) reunite for Christmas as they deal with a number of wacky situations and personal troubles.</p><p><em>Love the Coopers</em> is one of those family dramedies that focuses on a number of characters, most of whom are played by beloved actors like Keaton, Goodman, and others like Ed Helms, Marisa Tomei, and Amanda Seyfried, among others. But, as usual, Olivia Wilde stands out as beleaguered Cooper daughter Eleanor, who’s in a relationship with a married man and so desperate to arrive home with a significant other that she enlists the help of a soldier (Jake Lacy) she just met in the airport to pose as her fake boyfriend.</p><p><a href="https://www.amazon.com/Love-Coopers-Alan-Arkin/dp/B01AZ0VXLY/ref=sr_1_1?crid=2Z6TX61ZDJREY&keywords=love+the+coopers&qid=1656197931&s=instant-video&sprefix=love+the+coopers%2Cinstant-video%2C181&sr=1-1"><u><strong>Rent/Buy Love the Coopers on Amazon</strong></u></a><strong>.</strong></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="fkw8z7G8BFUuGLzEEqkzcd" name="booksmart.png" alt="booksmart cast" src="https://cdn.mos.cms.futurecdn.net/fkw8z7G8BFUuGLzEEqkzcd.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Annapurna Pictures)</span></figcaption></figure><h2 id="booksmart-hulu">Booksmart (Hulu)</h2><p>When teens Molly (Beanie Feldstein) and Amy (Kaitlyn Dever) realize that keeping their noses to the grindstone to achieve academically has unnecessarily put them behind when it comes to their social lives, they decide to spend the last night before graduating from high school to catch up on all the wild fun they missed, leading to a chaotic adventure.</p><p>Olivia Wilde came out strong with her feature length directorial debut, <em>Booksmart</em>, which premiered in May 2019. The movie was praised by critics and audience goers alike for its ensemble cast, smart storytelling, and heart, which still managed to provide lots of laughs. Absolutely a must-watch for anyone interested in Wilde’s work, it’s already made its way into the pantheon of <a href="https://www.cinemablend.com/news/2493936/cant-hardly-wait-and-13-other-epic-teen-movies-to-stream-or-rent-online"><u>epic teen movies</u></a>.</p><p><a href="https://www.hulu.com/movie/booksmart-032a0523-9fda-41bf-97c1-a44097b9e9fe"><u><strong>Stream Booksmart on Hulu</strong></u></a><strong>.<br></strong><a href="https://www.amazon.com/Booksmart-Kaitlyn-Dever/dp/B07T8KSZSH/ref=sr_1_1?crid=L3Y9HHJ8E6MG&keywords=booksmart&qid=1656197873&s=instant-video&sprefix=booksmart%2Cinstant-video%2C180&sr=1-1"><u><strong>Rent/Buy Booksmart on Amazon</strong></u></a><strong>.</strong></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="fZ9GosDix5dR8BeMJQXBbn" name="vinyl.png" alt="olivia wilde in vinyl" src="https://cdn.mos.cms.futurecdn.net/fZ9GosDix5dR8BeMJQXBbn.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: HBO)</span></figcaption></figure><h2 id="vinyl-digital-purchase">Vinyl (Digital Purchase)</h2><p>American Century Records founder and president Richie Finestra (Bobby Cannavale), tries to keep his company afloat in the 1970s as the love for rock and roll gives way to punk, rap, and disco, as his own commitment to his job is reignited because of a major event that just might be his ultimate downfall.</p><p>As Richie’s wife, Devon, Olivia Wilde once again proves that she excels at playing tough, capable women who refuse to back down from challenges and won’t succumb to acting as a victim when others’ poor decision-making threatens to mar her future.</p><p><a href="https://www.amazon.com/Vinyl-Season-1-Trailer/dp/B01EGH3BE4/ref=sr_1_1?crid=O1TVNJXDT5S2&keywords=vinyl&qid=1656197798&s=instant-video&sprefix=vinyl%2Cinstant-video%2C184&sr=1-1"><u><strong>Buy Vinyl on Amazon</strong></u></a><strong>.</strong></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="4KThd7ZkhjWWafwa6KQp4F" name="bojack.png" alt="bojack and charlotte in bojack horseman" src="https://cdn.mos.cms.futurecdn.net/4KThd7ZkhjWWafwa6KQp4F.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="bojack-horseman-netflix">BoJack Horseman (Netflix)</h2><p>After losing his once successful sitcom to a sudden cancellation, ‘90s TV star (and anthropomorphic horse) BoJack Horseman attempts to regain his pop culture cred by releasing an autobiography, all while dealing with addiction and depression.</p><p>Netflix’s <em>BoJack Horseman</em> dealt with a lot of serious issues for <a href="https://www.cinemablend.com/streaming-news/the-best-animated-shows-on-netflix-right-now-for-adults"><u>an animated show, even one made for adults</u></a>, but Olivia Wilde’s Charlotte Carson (an anthropomorphic deer) was a good and wise friend to the titular character whenever possible, despite her realization that she couldn’t get too caught up in BoJack’s usually self-destructive life.</p><p><a href="https://www.netflix.com/title/70300800"><u><strong>Stream BoJack Horseman on Netflix</strong></u></a><strong>.</strong></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="5CJHxQ8xUKyB9rRoJbxtFY" name="richard jewell.png" alt="olivia wilde in richard jewell" src="https://cdn.mos.cms.futurecdn.net/5CJHxQ8xUKyB9rRoJbxtFY.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Warner Bros. Pictures)</span></figcaption></figure><h2 id="richard-jewell-rental">Richard Jewell (Rental)</h2><p>This drama follows the real events surrounding the Centennial Olympic Park bombing at the 1996 Olympics, which saw security guard Richard Jewell find the device, alert authorities, and then be wrongly accused of the bombing himself.</p><p>Olivia Wilde took on the role of The Atlanta Journal-Constitution reporter, Kathy Scruggs, who wrote the article which revealed that Jewell was under suspicion for the bombing by the FBI. Her part is <a href="https://www.cinemablend.com/news/2486829/richard-jewell-how-historically-accurate-is-the-clint-eastwood-movie"><u>the one aspect of the film that was seen as controversial</u></a> upon its release, but Wilde still does a remarkable job as a woman who’s trying to stay ahead of what might be the biggest story of her career.</p><p><a href="https://www.amazon.com/gp/video/detail/amzn1.dv.gti.74b77dab-874f-9d2a-72b9-fe13c1a855ba?autoplay=0&ref_=atv_cf_strg_wb"><u><strong>Rent/buy Richard Jewell on Amazon</strong></u></a><strong>.</strong></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="D4RNX2pvB8NeackcB4HsDk" name="life itself.png" alt="olivia wilde in life itself" src="https://cdn.mos.cms.futurecdn.net/D4RNX2pvB8NeackcB4HsDk.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Amazon Studios)</span></figcaption></figure><h2 id="life-itself-rental">Life Itself (Rental)</h2><p>This 2018 drama connects several different couples across multiple generations, with everyone being linked by one, major event.</p><p>Olivia Wilde is, once again, at her cool, smart, tough lady best in <em>Life Itself</em> (which also stars Oscar Isaac, Annette Bening, Antonio Banderas, and many other big names), but a marked difference here is that her Abby gets to be part of a happy couple.</p><p><a href="https://www.amazon.com/gp/video/detail/amzn1.dv.gti.c6b9de29-454e-95a8-61e9-1a9d43522e5e?autoplay=0&ref_=atv_cf_strg_wb"><u><strong>Stream Life Itself on Amazon</strong></u></a><strong>.</strong></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="FhCHUyGKdYiEfoXX3FuDTD" name="in time.png" alt="olivia wilde in in time" src="https://cdn.mos.cms.futurecdn.net/FhCHUyGKdYiEfoXX3FuDTD.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: 20th Century Fox)</span></figcaption></figure><h2 id="in-time-rental">In Time (Rental)</h2><p>In a society where time is used as currency and every person has a clock on their body telling them how long they have to live, everyone also stops aging at 25.</p><p>While she doesn’t get much to do with her role as Rachel in <em>In Time</em>, you can bet that Olivia Wilde makes the most of her, um… <em>time</em> while playing the mother of Justin Timberlake’s character.</p><p><a href="https://www.amazon.com/Time-Justin-Timberlake/dp/B009YMO6SM/ref=sr_1_1?crid=UKTB1HOD46RB&keywords=in+time&qid=1656437210&s=instant-video&sprefix=%2Cinstant-video%2C227&sr=1-1"><u><strong>Rent/Buy In Time on Amazon</strong></u></a><strong>.</strong></p><p>This is just a small sampling of the movies and TV shows that Olivia Wilde has appeared in during her time in the spotlight, and you will rarely go wrong when choosing to watch a project that this talent has starred in.</p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ Kristen Schaal: What To Watch If You Like The Bob's Burgers Star ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/movies/kristen-schaal-what-to-watch-if-you-like-the-bobs-burgers-star</link>
                                                                            <description>
                            <![CDATA[ Kristen Schaal has been in a whole slew of hilarious projects; here's what to watch if you like her in The Bob's Burger Movie. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">kipFuC3KvN9QSdwAJMiGuD</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/TVDhbKQV3GxN5ERuhoQsXM-1280-80.png" type="image/png" length="0"></enclosure>
                                                                        <pubDate>Sat, 11 Jun 2022 13:04:16 +0000</pubDate>                                                                                                                                                                                                                                <category><![CDATA[Movies]]></category>
                                                                                                                    <dc:creator><![CDATA[ Carlie Hoke ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/kBfPL6fVCGFHTznye53qmM.png ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Carlie grew up in the middle of Appalachia in a tiny town known largely for its cave systems. Not a fan of the many mythic mountain creatures that roam the woods or spelunking, she moved to Richmond, VA as soon as she turned 18 and later graduated from VCU with a degree in Creative Advertising with a focus on Copywriting. After working through college in a number of motorcycle bars, dives, and 24 hour diners, she started freelance writing. She joined the CinemaBlend team back in 2020 as a TV and film news writer, and writes a feature every now and again. In addition to writing about all things Hollywood, she also creates blog content geared toward parents and readers. As a copywriter, she helps give women-owned businesses their voice.	&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What They&#039;re Into&lt;/strong&gt;: Carlie is into anything her 2-year-old son is into - right now it’s dinosaurs and videos of guys with chainsaws cutting down trees. Very niche. Seriously though, it’d be easier to say what she’s NOT into, because she likes pretty much anything that comes from a creative mind. As far as film and TV goes, her tastes are largely made up of B-Movie Bruce Campbell films, anything that Adam Sandler has so much as breathed on, and a genre she fondly refers to as “trash culture” - think Eastbound &amp;amp; Down and Always Sunny in Philadelphia. She doesn’t believe in bad movies, but her favorite is a toss up between The Crow and Dude Where’s My Car. Her favorite show is Psych, but she will throw down over Survivor being the best reality show ever created. She loves reading celebrity memoirs, watching Nic Cage talk about literally anything, and listening to her son try to pronounce &quot;Triceratops&quot;. 	&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What They&#039;re Excited About Right Now&lt;/strong&gt;: The Brenaissance, Mindy Kaling&#039;s Scooby Doo spin-off, pretty much anything A24 has to offer from now until the end of time, and her morning coffee.&lt;/p&gt; ]]></dc:description>
                                                                                                                                <cf:isSponsored>false</cf:isSponsored>
                <cf:hasAffiliateLinks>false</cf:hasAffiliateLinks>
                <cf:isPaid>false</cf:isPaid>
                                                                                                                                <media:content type="image/png" url="https://cdn.mos.cms.futurecdn.net/TVDhbKQV3GxN5ERuhoQsXM-1280-80.png">
                                                            <media:credit><![CDATA[Fox]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[kristen schaal in the last man on earth on fox]]></media:description>                                                            <media:text><![CDATA[kristen schaal in the last man on earth on fox]]></media:text>
                                <media:title type="plain"><![CDATA[kristen schaal in the last man on earth on fox]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/TVDhbKQV3GxN5ERuhoQsXM-1280-80.png" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>It’s a pretty special feeling when you can recognize someone by their voice alone, and <em>The Bob’s Burgers Movie</em> star Kristen Schaal is certainly an actress that is instantly recognizable upon hearing her unique and quirky voice. Schaal is a comedic actress who, despite <a href="https://www.cinemablend.com/television/2571664/bobs-burgers-kristen-schaal-fired-from-south-park-after-a-month"><u>being fired from </u><u><em>South Park</em></u><u> early in her career</u></a>, not only lends her voice to some of the most fun animated movies and series of our time, but also acts in some pretty great live action roles, as well. Here are some great Kristen Schaal movies and tv shows that are a real good time if you like the lovable actress.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="3azmipPHhBHjhk9pLysGSL" name="Screen Shot 2022-06-07 at 8.17.01 AM.png" alt="Kristen Schaal as Louise in Bob's Burgers" src="https://cdn.mos.cms.futurecdn.net/3azmipPHhBHjhk9pLysGSL.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Hulu)</span></figcaption></figure><h2 id="bob-x2019-s-burgers-hulu">Bob’s Burgers (Hulu)</h2><p>Centered on a family in New Jersey who live above the burger joint they run together, <em>Bob’s Burgers</em> is an animated comedy series that brings a lot of eccentric and lovable characters together. Bob, the male head of the Belcher family, is basically the Gordon Ramsey of burgers, but even though his food is to die for, he&apos;s struggling to make ends meet and keep his restaurant and chef dreams alive.</p><p>Honestly, <em>Bob’s Burgers</em> is the ultimate comfort show. It’s like the series form of a warm hug, and always manages to make you feel good even though it does handle some rough topics at times. Kristen Schaal voices Louise, the youngest of the three Belcher children, and her sweet voice acts as a kind of foil to Louise’s chaotic nature. The ongoing show has 12 bingeable seasons full of <a href="https://www.cinemablend.com/television/2567243/the-best-bobs-burgers-episodes-ranked"><u>some pretty great episodes</u></a> and a 2022 film that&apos;s part of the <a href="https://www.cinemablend.com/news/2569630/2022-new-movie-release-dates-full-schedule-of-all-the-upcoming-movies"><u>new movie releases</u></a>, so be prepared to be in it for the long haul with this gem.</p><p><a href="https://www.hulu.com/series/bobs-burgers-fdeb1018-4472-442f-ba94-fb087cdea069"><u><strong>Stream Bob’s Burgers on Hulu.</strong></u></a><u><strong><br></strong></u><a href="https://www.amazon.com/Hamburger-Dinner-Theater/dp/B004I0C0QK/ref=sr_1_3?crid=1NBMQVR54X7DO&keywords=bob%27s+burgers&qid=1654567546&sprefix=bob%27s+burgers%2Caps%2C76&sr=8-3"><u><strong>Buy Bob’s Burgers on Amazon.</strong></u></a></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="vVggycsxcokA4Y38YvE3Rg" name="Screen Shot 2022-06-07 at 9.48.45 AM.png" alt="Kristen Schaal in The Last Man on Earth" src="https://cdn.mos.cms.futurecdn.net/vVggycsxcokA4Y38YvE3Rg.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Fox)</span></figcaption></figure><h2 id="the-last-man-on-earth-hulu">The Last Man On Earth (Hulu)</h2><p>While the title is pretty self explanatory, <em>The Last Man on Earth</em> centers on a man, played by the series creator Will Forte, who believes himself to be the last man living on Earth after a virus wipes out humanity. After leaving signs of his survival and stealing major historical and cultural artifacts all over the continental US, he finally locates another survivor, played by Kristen Schaal, whom he finds to be one of the most annoying people he has ever met, but feels obligated to repopulate the planet with her.</p><p><em>The Last Man on Earth</em> is a hilarious take on a post-apocalyptic world. It’s like <em>Zombieland</em> without the zombies and with less people. While Will Forte and Kristen Schaal’s intense characters bring a ton of comedy to the series, it’s a show that has some real depth to it and explores mankind’s inner workings. If you love Schaal’s sense of humor but prefer a live action series, <em>The Last Man on Earth</em> is probably exactly what you’re looking for.</p><p><a href="https://www.hulu.com/series/the-last-man-on-earth-ebb4d292-6d2c-4b93-98e6-b03406954151"><u><strong>Stream The Last Man on Earth on Hulu.</strong></u></a><u><strong><br></strong></u><a href="https://www.amazon.com/Alive-Tucson-Elephant-Room/dp/B00TDJKT3M/ref=sr_1_1?crid=3OGGJD37V1LPG&keywords=the+last+man+on+earth&qid=1654568568&sprefix=the+last+man+on+earth%2Caps%2C164&sr=8-1"><u><strong>Buy The Last Man on Earth on Amazon.</strong></u></a></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="6KRK7uUquWcWZ2f7DJdzkC" name="Screen Shot 2022-06-06 at 10.55.55 PM.png" alt="Kristen Schaal in Season 1 of The Heart, She Holler" src="https://cdn.mos.cms.futurecdn.net/6KRK7uUquWcWZ2f7DJdzkC.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Adult Swim)</span></figcaption></figure><h2 id="the-heart-she-holler-hbo-max">The Heart, She Holler (HBO Max)</h2><p>Just looking at the title, you probably have no clue what to expect from <em>The Heart, She Holler </em>and I would implore you to just go ahead and dive in blind, because it is quite the experience. However, here’s a little explanation: it’s like if <em>Trailer Park Boys</em> and <em>Schitt’s Creek</em> had a baby, and that baby grew up on a steady diet of <em>Days of Our Lives</em> and a whole lot of vintage horror flicks. The plot of the show really doesn’t matter in the grand scheme of everything that is going on there, but basically Patton Oswalt’s isolated character inherits a town and comes back to run it surrounded by a number of questionable characters.</p><p><em>The Heart, She Holler</em> is unhinged, and that’s putting it lightly. Fans of Kristen Schaal will be used to a good amount of weirdness and unexpected humor, and this Adult Swim series is great for gauging just how much chaos you can handle.</p><p><a href="https://www.hbomax.com/series/urn:hbo:series:GXbonuQgsfXepwwEAABfE"><u><strong>Stream The Heart, She Holler on HBO Max.</strong></u></a><u><strong><br></strong></u><a href="https://www.amazon.com/And-So-It-Begends/dp/B009WZR728/ref=sr_1_1?crid=1ELY63VIBOLBB&keywords=the+heart%2C+she+holler&qid=1654570084&s=instant-video&sprefix=the+heart%2C+she+holler%2Cinstant-video%2C69&sr=1-1"><u><strong>Buy The Heart, She Holler on Amazon.</strong></u></a></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="RQUuwVgcAxNNxMtoPSDQN6" name="Screen Shot 2022-06-07 at 12.01.08 AM.png" alt="Kristen Schaal as The Guide in What We Do in the Shadows" src="https://cdn.mos.cms.futurecdn.net/RQUuwVgcAxNNxMtoPSDQN6.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: FX)</span></figcaption></figure><h2 id="what-we-do-in-the-shadows-hulu">What We Do In The Shadows (Hulu)</h2><p><em>What We Do in the Shadows</em> is a comedy series about a group of <a href="https://www.cinemablend.com/interviews/what-we-do-in-the-shadows-producers-explain-the-bizarre-part-of-vampire-lore-theyve-repeatedly-tried-to-use"><u>bizarre vampires</u></a> who have been roommates for hundreds of years. The series, based on a previously made film of the same name, is shot mockumentary style and follows the nights of the group of vampire friends. It’s kind of like if the <em>Friends</em> friends were vampires.</p><p>For people who like Kristen Schaal and the regular crowd she tends to team up with, <em>What We Do in the Shadows</em> is a must. Schaal has a relatively large recurring role in the series as The Guide, a vampire who works for the vampire council in summoning vampires accused of crimes. The humor in the series is A+, and right up Schaal’s alley.</p><p><a href="https://www.hulu.com/series/0b10c46a-12f0-4357-8a00-547057b49bac"><u><strong>Stream What We Do in the Shadows on Hulu.</strong></u></a><u><strong><br></strong></u><a href="https://www.amazon.com/Pilot/dp/B07PLS94TH/ref=sr_1_2?crid=6AUQVC5N79SG&keywords=what+we+do+in+the+shadows&qid=1654572849&s=instant-video&sprefix=what+we+do+in+the+shadows%2Cinstant-video%2C65&sr=1-2"><u><strong>Buy What We Do in the Shadow on Amazon.</strong></u></a></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="PCQVYo8yirUkktkixdfxGV" name="Screen Shot 2022-06-07 at 9.55.09 AM.png" alt="Kristen Schaal in Flight of the Conchords" src="https://cdn.mos.cms.futurecdn.net/PCQVYo8yirUkktkixdfxGV.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: HBO)</span></figcaption></figure><h2 id="flight-of-the-conchords-hbo-max">Flight Of The Conchords (HBO Max)</h2><p>Created by stars Jemaine Clement and Bret McKenzie, <em>Flight of the Conchords</em> sees the two play fictionalized versions of themselves as they leave New Zealand for The Big Apple to make a go of it as folk music artists.</p><p><em>Flight of the Conchords</em> is another series that puts Kristen Schaal alongside people she frequently works with, and the effect is awesome. Schaal plays a super fan (pretty much the only fan) of the titular band. She’s borderline obsessive and appears in a majority of the episodes. <em>Flight of the Conchords</em> is a gem of a show, and was at near the beginning of Schaal’s now extensive comedy career, so it’s a great one to revisit.</p><p><a href="https://www.hbomax.com/series/urn:hbo:series:GVU2fVwUV4FFvjSoJAUAV"><u><strong>Stream Flight of the Conchords on HBO Max.</strong></u></a><u><strong><br></strong></u><a href="https://www.amazon.com/Sally/dp/B003OUS1AY/ref=sr_1_1?crid=2ZXOZ3YP1PB78&keywords=flight+of+the+conchords&qid=1654573217&s=instant-video&sprefix=flight+of+the+conchords%2Cinstant-video%2C69&sr=1-1"><u><strong>Buy Flight of the Conchords on Amazon.</strong></u></a></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="rUakC7J7qquNoLacYJ39Ad" name="Screen Shot 2022-06-06 at 11.11.53 PM.png" alt="Will Arnett and Kristen Schaal's BoJack Horseman characters" src="https://cdn.mos.cms.futurecdn.net/rUakC7J7qquNoLacYJ39Ad.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="bojack-horseman-2">BoJack Horseman</h2><p>BoJack Horseman centers around a horse, voiced by Will Arnett, who is struggling with depression and addiction after his very popular show was canceled. It’s an adult, animated comedy series that is honestly pretty dark, but that the stark realness of the show is foiled by how incredibly satirical it is, is just one of the many brilliances that come from the series.</p><p>While Kristen Schaal isn’t a main character of the series, her recurring character of Sarah Lynn reflects some of the same themes as the titular BoJack character. This dark satirical take on real life struggles and ideas is a theme fans can see in a number of Schaal’s projects, and <em>BoJack Horseman</em> is one that does it extremely well, making it definitely worth checking out if you haven’t already.</p><p><a href="https://www.netflix.com/title/70300800"><u><strong>Stream BoJack Horseman on Netflix.</strong></u></a><u><strong><br></strong></u><a href="https://www.amazon.com/BoJack-Horseman-Seasons-One-Collectors/dp/B07R76QF7M/ref=sr_1_3?crid=37D935NPL9J9Q&keywords=bojack+horseman&qid=1654571739&s=instant-video&sprefix=bojack+horseman%2Cinstant-video%2C67&sr=1-3-catcorr"><u><strong>Buy BoJack Horseman on Blu-ray/DVD on Amazon.</strong></u></a></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="pgP9N9YfJ8oFQVMFTaaMC3" name="Screen Shot 2022-06-07 at 9.57.25 AM.png" alt="Kristen Schaal and Nick Kroll in Our Flag Means Death" src="https://cdn.mos.cms.futurecdn.net/pgP9N9YfJ8oFQVMFTaaMC3.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: HBO)</span></figcaption></figure><h2 id="our-flag-means-death-hbo-max">Our Flag Means Death (HBO Max)</h2><p>A romantic, adventure comedy about pirates <a href="https://www.cinemablend.com/movies/taika-waititi-calls-himself-the-laziest-actor-as-he-talks-prep-for-roles-like-our-flag-means-death-and-thor-ragnaroks-korg"><u>starring </u><u><em>Thor: Love and Thunder</em></u><u>’s Taika Waititi</u></a>? I am beyond on board. The new series centers around a rich aristocrat in the early 1700s who decides he wants to give it all up and become a pirate. Cue the hilarity. </p><p>Fans of Kristen Schaal will love this show, as it has plenty of connections to her other projects like <em>Flight of the Conchords</em> and <em>What We Do in the Shadows</em>, making the on screen chemistry between her and the other comedic actors A+, and giving fans a very familiar comedy style. Schaal has only appeared in a few episodes so far, but fans will fondly find the show akin to her other works. </p><p><a href="https://www.hbomax.com/series/urn:hbo:series:GYf3LzwJV98JifQEAAAAO"><u><strong>Stream Our Flag Means Death on HBO Max.</strong></u></a></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="DkQ3355nM8FjLzAsXnUwuV" name="Screen Shot 2022-06-06 at 11.58.09 PM.png" alt="Kristen Schaal as Mabel in Gravity Falls" src="https://cdn.mos.cms.futurecdn.net/DkQ3355nM8FjLzAsXnUwuV.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Disney)</span></figcaption></figure><h2 id="gravity-falls-hulu">Gravity Falls (Hulu)</h2><p>After being sent to the titular town in Oregon to live with their eccentric uncle, the Dipper twins are thrown into the mystical secrets that Gravity Falls has to unveil. The Kristen Schaal and Jason Ritter led animated series is kind of like a cross between <em>Scooby Doo</em> and <em>Haven</em> with a lot of endearing humor. </p><p><em>Gravity Falls</em> won two Primetime Emmys and is beloved by children, teens, and adults alike. It’s a little different than the more mature dark comedies and adult-humored projects Kristen Schaal is a part of, but <em>Gravity Falls</em> is one of the very few productions that almost everyone can agree is superb, with both seasons earning a place on the very select list of productions <a href="https://www.rottentomatoes.com/tv/gravity_falls"><u>with 100% on Rotten Tomatoes</u></a>.</p><p><a href="https://www.hulu.com/series/5d931e25-bd29-46f2-9baf-b5a0b4c001f8"><u><strong>Stream Gravity Falls on Hulu.</strong></u></a><u><strong><br></strong></u><a href="https://www.amazon.com/Tourist-Trapped/dp/B0097WHW8A/ref=sr_1_1?crid=2LQQZ2U19MA6H&keywords=gravity+falls&qid=1654573318&s=instant-video&sprefix=gravity+falls%2Cinstant-video%2C66&sr=1-1"><u><strong>Buy Gravity Falls on Amazon.</strong></u></a></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="kRcem5hhiRYEcUtGbnJ9xP" name="Screen Shot 2022-06-06 at 11.54.25 PM.png" alt="Kristen Schaal in 30 Rock" src="https://cdn.mos.cms.futurecdn.net/kRcem5hhiRYEcUtGbnJ9xP.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="30-rock-hulu">30 Rock (Hulu)</h2><p>Created, written, and starring <a href="https://www.cinemablend.com/streaming-news/the-best-tina-fey-movies-and-tv-shows-and-how-to-watch-them"><u>the great Tina Fey</u></a>, <em>30 Rock</em> is a comedy series based on her time as head writer for <em>Saturday Night Live</em>. <a href="https://www.cinemablend.com/television/2571155/30-rock-cast-what-the-nbc-comedy-stars-are-doing-now-including-tina-fey"><u>The cast of </u><u><em>30 Rock</em></u></a> includes big names like Alec Baldwin and Tracy Morgan and it won an impressive 16 Primetime Emmys. </p><p>I love Kristen Schaal in <em>30 Rock</em>, even though she had a small recurring role. She is her regular chaotic self in the series and is a nice addition to the many different strong and satirical characters that are present through the entire seven seasons of the series.</p><p><a href="https://www.hulu.com/series/30-rock-44e1031e-f7ac-443d-86d2-7a2eaa26ed5b"><u><strong>Stream 30 Rock on Hulu.</strong></u></a><u><strong><br></strong></u><a href="https://www.amazon.com/Pilot/dp/B000U5OHI6/ref=sr_1_1?crid=3EJJGNZENGAKR&keywords=30+rock&qid=1654573382&s=instant-video&sprefix=30+rock%2Cinstant-video%2C63&sr=1-1"><u><strong>Buy 30 Rock on Amazon.</strong></u></a></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="ntMToRiqKkRkn8TBZYi3dT" name="Screen Shot 2022-06-07 at 10.01.19 AM.png" alt="Kristen Schaal's character in the end credit scene of Toy Story 3" src="https://cdn.mos.cms.futurecdn.net/ntMToRiqKkRkn8TBZYi3dT.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Disney)</span></figcaption></figure><h2 id="the-toy-story-franchise-disney">The Toy Story Franchise (Disney+)</h2><p><em>Toy Story</em> is one of Disney / Pixar&apos;s most popular and recognizable franchises and it spans over 20 years, reaching generations of children. The franchise is centered on a group of toys that come alive when no one is watching and get into all kinds of sticky situations, helping each other as a team along the way.</p><p><em>Toy Story</em> is beloved and holds a special place in a lot of people’s hearts. Kristen Schaal joined the <a href="https://www.cinemablend.com/movies/toy-story-what-the-original-voice-cast-is-doing-now"><u><em>Toy Story</em></u><u> cast</u></a> in the third film as the triceratops toy, Trixie, and fans will recognize her voice pretty instantly as a nice addition. She is a relatively minor character, although Trixie is the central figure in one of the franchise’s shorts, <em>Toy Story That Time Forgot</em>.</p><p><a href="https://www.disneyplus.com/franchise/toy-story"><u><strong>Stream the Toy Story franchise on Disney+.</strong></u></a><u><strong><br></strong></u><a href="https://www.amazon.com/Toy-Story-4-Movie-Collection-Bonus/dp/B08V1Q6JX1/ref=sr_1_6?crid=1V4BRGR1ZY1NE&keywords=toy+story&qid=1654573516&s=instant-video&sprefix=toy+story%2Cinstant-video%2C72&sr=1-6"><u><strong>Buy the Toy Story franchise on Amazon.</strong></u></a></p><p>With <em>The Bob’s Burgers Movie</em> recently released in theaters and <a href="https://www.cinemablend.com/movies/the-bobs-burgers-movie-review-well-done"><u>getting rave reviews</u></a>, now is pretty much the perfect time to revisit some of Kristen Schaal’s best roles, or even watch some of them for the first time. Luckily, pretty much everything notable she has worked on is available to stream online, but for now you’ll have to head into theaters for her newly released film. I know, what a drag. </p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ 10 Movies And Shows With Great LGBTQ+ Representation To Watch On Netflix ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/2570993/movies-and-shows-with-great-lgbtq-representation-to-watch-on-netflix</link>
                                                                            <description>
                            <![CDATA[ Here are 10 shows and movies on Netflix with A+ LGBTQ+ rep. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">aLndCWmCnhEkeKVq9JJJri</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/LVikCXANAvzDh64E7H8zDj-1280-80.png" type="image/png" length="0"></enclosure>
                                                                        <pubDate>Fri, 03 Jun 2022 19:54:37 +0000</pubDate>                                                                                                                                                                                                                                <category><![CDATA[Streaming News]]></category>
                                                                                                                    <dc:creator><![CDATA[ Rachel Romean ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/MsTCXdXjxogAbSGQrrxkXZ.png ]]></dc:source>
                                                                <dc:description><![CDATA[ null ]]></dc:description>
                                                                                                                                <cf:isSponsored>false</cf:isSponsored>
                <cf:hasAffiliateLinks>false</cf:hasAffiliateLinks>
                <cf:isPaid>false</cf:isPaid>
                                                                                                                                <media:content type="image/png" url="https://cdn.mos.cms.futurecdn.net/LVikCXANAvzDh64E7H8zDj-1280-80.png">
                                                            <media:credit><![CDATA[CBC]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[dan levy david rose schitt&#039;s creek screenshot youtube]]></media:description>                                                            <media:text><![CDATA[dan levy david rose schitt&#039;s creek screenshot youtube]]></media:text>
                                <media:title type="plain"><![CDATA[dan levy david rose schitt&#039;s creek screenshot youtube]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/LVikCXANAvzDh64E7H8zDj-1280-80.png" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p><strong>Spoiler Warning: there may be minor spoilers throughout, but nothing major, we promise. We would never do that to you.</strong></p><p>LGBTQ+ representation in the media has come a long way in a few short decades. Shows like <em>Glee</em> and <em>Will and Grace</em> have gone from seeming ground-breaking to being the standard in less than 20 years. While there’s still work to be done, LGBTQ+ characters are being featured in more shows and movies than ever before – and much of that content is easily accessible to anyone with a <a href="https://www.cinemablend.com/streaming-news/netflix-subscription-the-plans-the-price-and-whats-included"><u>Netflix subscription</u></a>. Don’t know where to start? Here’s a list of ten TV shows and <a href="https://www.cinemablend.com/news/2553720/the-best-movies-on-netflix-right-now">movies on Netflix</a> with positive LGBTQ+ rep.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="HpT2jgj3msGgnF2Dk4u7S7" name="heartstopper.jpg" alt="Heartstopper on Netflix" src="https://cdn.mos.cms.futurecdn.net/HpT2jgj3msGgnF2Dk4u7S7.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="heartstopper">Heartstopper</h2><p><em>Heartstopper </em>was released in 2022 and immediately gave Netflix subscribers<a href="https://www.cinemablend.com/streaming-news/heartstopper-reasons-you-should-check-out-this-sweet-teen-dramedy"> <u>plenty of reasons</u></a> to enjoy the romantic coming-of-age drama about two teenagers whose friendship grows into something more. Based on Alice Oseman’s graphic novel of the same name, the series follows Charlie Spring (Joe Locke) a young schoolboy who falls madly in love with Nick Nelson (Kit Connor), a popular athlete who sits next to him in class. </p><p>The series was an instant hit upon release with English-speaking audiences and has remained popular ever since its debut. So popular in fact, Netflix picked up the series for not one but<a href="https://www.cinemablend.com/streaming-news/netflix-just-gave-one-of-its-best-new-shows-a-two-season-renewal"><u> two additional seasons</u></a> in May 2022.</p><p><a href="https://www.netflix.com/title/81059939"><u><strong>Stream Heartstopper on Netflix.</strong></u></a></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="ekXgQ4diwgmP95CtEkA3yN" name="The Boys in the Band.jpg" alt="The Boys in the Band cast" src="https://cdn.mos.cms.futurecdn.net/ekXgQ4diwgmP95CtEkA3yN.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="the-boys-in-the-band">The Boys In The Band</h2><p>Based on the 1968<a href="https://www.cinemablend.com/news/2553819/netflixs-the-boys-in-the-band-trailer-ryan-murphy-brings-beloved-play-to-life-with-a-killer-cast"> <u>Off-Broadway play of the same name</u></a>, <em>The Boys in the Band</em>  centers on Michael (Jim Parsons), an Upper East-Sider who throws a birthday party for one of his closest friends. The party, however, goes awry when Michael’s college roommate, Alan (Brian Hutchison), stops by and changes the mood of the gathering.</p><p>The 2020 Netflix movie features the actors of the 2018 Broadway revival of <em>The Boys in the Band</em>, which consisted of an entirely openly-gay cast. With equal parts comedy and tragedy, the movie provides a whirlwind of emotions for the characters and viewer alike.</p><p><a href="https://www.netflix.com/title/81000365"><u><strong>Stream The Boys in the Band on Netflix.</strong></u></a></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="W76R3QW59eR6YZ86j3N2U7" name="gatwa2.jpg" alt="Ncuti Gatwa and Asa Butterfield in Sex Education on Netflix" src="https://cdn.mos.cms.futurecdn.net/W76R3QW59eR6YZ86j3N2U7.jpg" mos="https://cdn.mos.cms.futurecdn.net/JBRdbCHcKvVDonSHrHircB.jpg" align="" fullscreen="" width="1280" height="720" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="sex-education">Sex Education</h2><p><em>Sex Education</em> is a Netflix original series that originally premiered in 2019. The show follows British teen Otis (Asa Butterfield) and his mother Jean (Gillian Anderson), a sex therapist. Hijinks ensue when Otis starts using his mother’s sexual expertise to counsel his classmates. When it comes to LGBTQ+ representation, <em>Sex Education</em> is a prime example of both quality and quantity.</p><p>In addition to Otis’ best friend Eric (Ncuti Gatwa), whose coming-out journey is both nuanced and triumphant, there are several fully-fleshed LGBTQ+ characters of varying identities that round out the excellent ensemble cast. None of the LGBTQ+ characters are tokenized or shoved into the story as props. They’re allowed to exist as real human beings. Now is a great time to get caught up with the students of Moordale Secondary School, since the show has been <a href="https://www.cinemablend.com/television/2460075/what-netflix-has-cancelled-and-renewed"><u>picked up for a fourth season</u></a>. </p><p><a href="https://www.netflix.com/title/80197526"><u>Stream Sex Education</u><u><strong> on Netflix.</strong></u></a></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="ADghjTTzGrZJYS6Cu5oMok" name="the_half_of_it_THOI_Unit_00348r_rgb.0 (1).jpg" alt="Ellie in The Half of It." src="https://cdn.mos.cms.futurecdn.net/ADghjTTzGrZJYS6Cu5oMok.jpg" mos="https://cdn.mos.cms.futurecdn.net/8zj2Qt8fxt3pm7LuvyRe36.jpg" align="" fullscreen="" width="1280" height="720" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="the-half-of-it">The Half Of It</h2><p>Many LGBTQ+ films tend to be heart-wrenching tales of struggle (there’s a reason the trope is called ‘bury your gays.’ We’re still not over Lexa, from <em>The 100</em>). While those stories are completely valid and necessary, it’s important to include LGBTQ+ rep in all film genres. <em>The Half of It</em> (another Netflix original) is sweet, fun, and just a bit unrealistic - everything a high school rom-com should be. It also features a queer Chinese-American main character.</p><p>Starring Leah Lewis, Daniel Diemer, and Alexxis Lemire, the movie follows Ellie Chu, a quiet student who starts ghostwriting love letters for her classmate, Paul. The only problem? Aster Flores, the recipient of Paul’s affections, is also Ellie’s crush. A little bit <em>Love, Simon</em>, a little bit <em>To All the Boys I’ve Loved Before</em>, <em>The Half of It</em> <a href="https://www.cinemablend.com/news/2495613/netflixs-the-half-of-it-movie-is-based-on-a-real-life-story">successfully adds a queer twist</a> to an otherwise standard rom-com plot.</p><p><a href="https://www.netflix.com/title/81005150"><u><strong>Stream The Half of It on Netflix.</strong></u></a></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="69r7w5CgJjg6B9ofoBAudi" name="fear-street.jpeg" alt="Kiana Madeira and Olivia Scott Welch in Fear Street" src="https://cdn.mos.cms.futurecdn.net/69r7w5CgJjg6B9ofoBAudi.jpeg" mos="https://cdn.mos.cms.futurecdn.net/iD8WfiQiZk4D6MTSEQU9Re.jpg" align="" fullscreen="" width="1280" height="720" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="the-fear-street-trilogy">The Fear Street Trilogy</h2><p>The horror genre tends to avoid representing LGBTQ+ people – and when they are represented, they tend to die early in the film or fall victim to the ‘bury your gays’ trope. The <a href="https://www.cinemablend.com/news/2553658/2021-new-movie-releases-the-full-movie-release-date-schedule">2021 movies</a> in the <em>Fear Street</em> trilogy (<a href="https://www.cinemablend.com/news/2567670/rl-stine-reveals-netflixs-fear-street-movies-will-differ-from-books-horror">loosely based on the R.L. Stine book series</a> of the same name) are different. The films were directed by Leigh Janiak, and star Kiana Madeira and Olivia Scott Welch, along with <em>Stranger Things</em> vets Maya Hawke and Sadie Sink. Madeira and Scott Welch play Sam and Deena, two teenagers whose romantic relationship is central to the plot. </p><p>And, (<strong>minor spoiler ahead</strong>) even better, they get a happy ending. If you can name another horror movie that stars an LGBTQ+ couple where neither one dies by the end, I will be very, very impressed.<br><br><a href="https://www.netflix.com/title/81325689"><u><strong>Stream Fear Street Part One: 1994 on Netflix.</strong></u></a><br><a href="https://www.netflix.com/title/81334749"><u><strong>Stream Fear Street Part Two: 1978 on Netflix.</strong></u></a><br><a href="https://www.netflix.com/title/81334750"><u><strong>Stream Fear Street Part Three: 1666 on Netflix.</strong></u></a></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:512px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="92TEMtyzRBkhABaPVKLFVZ" name="unnamed (4).jpg" alt="BoJack in BoJack Horseman" src="https://cdn.mos.cms.futurecdn.net/92TEMtyzRBkhABaPVKLFVZ.jpg" mos="https://cdn.mos.cms.futurecdn.net/wY7t5DWUMUXqoFQKja4wgc.jpg" align="" fullscreen="" width="512" height="288" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="bojack-horseman-3">BoJack Horseman</h2><p>It’s one of the <a href="https://www.cinemablend.com/television/2564797/the-best-shows-to-binge-watch-on-netflix-right-now">best shows on Netflix</a>, but <em>BoJack Horseman</em> has very few actual LGBTQ+ characters. So, why is <a href="https://www.cinemablend.com/television/2489982/how-bojack-horsemans-will-arnett-feels-about-saying-goodbye-to-the-netflix-comedy">the story of an alcoholic animated horse</a> on this list? Two words: Todd Chavez. Voiced by <em>Breaking Bad’s</em> Aaron Paul, the 20-something slacker starts off as BoJack’s couch-hopping roommate and ends the series fully secure in his identity as an asexual man. Few, if any, television shows include asexual characters, let alone feature them or portray them in a happy romantic relationship.<br><br><em>BoJack Horseman</em> allows Todd to come to terms with his identity in a realistic and affirming way. The only caveat is that Todd’s exploration of his sexuality doesn’t begin until halfway through the series. However, his character’s journey is handled so well that the last few seasons of <em>BoJack Horseman</em> should be required viewing for anyone seeking to write an LGBTQ+ character.<br><br><a href="https://www.netflix.com/title/70300800"><u><strong>Stream BoJack Horseman on Netflix.</strong></u></a></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="jw9LcXYALCTUwkZzzW4M7G" name="lydia.jpeg" alt="Rita Moreno as Lydia on One Day at a Time" src="https://cdn.mos.cms.futurecdn.net/jw9LcXYALCTUwkZzzW4M7G.jpeg" mos="https://cdn.mos.cms.futurecdn.net/LWwvhK5cVUmMFTfA2H2487.jpg" align="" fullscreen="" width="1280" height="720" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: Act III Productions)</span></figcaption></figure><h2 id="one-day-at-a-time">One Day At A Time</h2><p>The original iteration of <a href="https://www.cinemablend.com/television/2468816/why-netflixs-one-day-at-a-time-really-is-worth-your-time"><em>One Day at a Time</em></a> was sweet, but definitely skewed towards the white and heteronormative. The Netflix remake took one look at that show and said no, we’re good. Rebooted with a Latinx main cast, the show features Justina Machado as Penelope Alvarez, a newly single mother with two teenage children.<br><br>Her daughter, Elena (Isabella Gomez), realizes she’s a lesbian in Season 1 and starts dating Syd, a non-binary classmate, in Season 2. Elena calls Syd her ‘syd-nificant other,’ an adorable tidbit that sold me on starting the show last year. <em>One Day at a Time</em> was sadly cancelled after four seasons but remains a wonderfully endearing entry to the LGBTQ+ canon. Also: Rita Moreno. Need I say more?<br><br><a href="https://www.netflix.com/title/80095532"><u><strong>Stream One Day at a Time on Netflix.</strong></u></a></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="wtfRSmbpmDZFEvFx9afDHB" name="ohara cast.jpg" alt="Schitt's Creek cast" src="https://cdn.mos.cms.futurecdn.net/wtfRSmbpmDZFEvFx9afDHB.jpg" mos="https://cdn.mos.cms.futurecdn.net/j6C7AWx8AxuCwhLMcBinwM.jpg" align="" fullscreen="" width="1280" height="720" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: Pop)</span></figcaption></figure><h2 id="schitt-s-creek">Schitt’s Creek</h2><p><em>Schitt’s Creek</em> might be an obvious pick, but it’s an excellent show nonetheless. Dan Levy stars as David, a pansexual ex-art gallery manager forced to move to a podunk town with his affluent family after they lose their fortune. David’s identity is discussed but never becomes a point of contention. Dan Levy has said that <a href="https://www.cinemablend.com/television/2549466/schitts-creek-creator-responds-to-criticisms-about-the-shows-take-on-social-issues">he specifically omitted homophobia</a> from his comedy to show a more accepting world than the one viewers live in now. Some fans claimed he was simply avoiding addressing social issues, but in reality, <em>Schitt’s Creek</em> gives viewers a model for how society could and should be. How can people create a better world if they don’t know what it should look like? The <a href="https://www.cinemablend.com/television/2488900/schitts-creek-the-funniest-characters-and-the-cast-members-who-play-them"><u>residents of Schitt’s Creek</u></a> have problems, but they mostly have to do with Moira’s penchant for dramatics and Patrick’s ugly shoes.<br><br><a href="https://www.netflix.com/title/80036165"><u><strong>Stream Schitt’s Creek on Netflix.</strong></u></a></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="w36WvFGMvzQt3Z2PwkXgdV" name="elisa-and-marcela (1).jpg" alt="The two main characters in Elisa and Marcela." src="https://cdn.mos.cms.futurecdn.net/w36WvFGMvzQt3Z2PwkXgdV.jpg" mos="https://cdn.mos.cms.futurecdn.net/ryGzqWhwaS33nijQeH6utL.jpg" align="" fullscreen="" width="1280" height="720" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="elisa-amp-marcela">Elisa & Marcela</h2><p>LGBTQ+ people have always existed - they just tend to be omitted from history textbooks. The Netflix original movie <em>Elisa & Marcela</em> is based on the true story of two women who became the first same-sex couple to be married in Spain. Elisa (Natalia de Morena) and Marcela (Greta Fernández) are two women who masquerade as a heterosexual couple to get the church to marry them, with Elisa assuming a male identity. <em>Elisa & Marcela</em> admittedly glosses over the rougher aspects of the couple’s story, but the movie is visually stunning and offers enough drama to keep viewers entertained.<br><br><a href="https://www.netflix.com/title/80121387"><u><strong>Stream Elisa & Marcela on Netflix.</strong></u></a></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="TiPWpSwnQGE3Do3cUeoc5P" name="Catra-and-Adora (1).jpg" alt="Catra and Adora in She-Ra and the Princesses of Power." src="https://cdn.mos.cms.futurecdn.net/TiPWpSwnQGE3Do3cUeoc5P.jpg" mos="https://cdn.mos.cms.futurecdn.net/74xuxc4Mj3nUTnuMryuffc.jpg" align="" fullscreen="" width="1280" height="720" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="she-ra-and-the-princesses-of-power">She-Ra And The Princesses Of Power</h2><p>Yes, <em>She-Ra and the Princesses of Power</em> is a Netflix reboot of the &apos;80s <em>He-Man</em> spinoff intended for a target audience of kids 8-14. That being said, it also includes some stand-out LGBTQ+ rep that would have never been included in a cartoon when I was that age (and trust me, I watched a lot of TV as a kid). The lack of LGBTQ+ representation in kids media was so severe that Korra and Asami <a href="https://www.cinemablend.com/television/2552907/how-legend-of-korras-voice-actress-feels-about-korrasami-today">holding hands in the series finale</a> of <em>The Legend of Korra</em> felt revolutionary.<br><br>The romantic relationship between Adora (Aimee Carrera) and Catra (AJ Michalka) is a testament to the tenacity of <em>She-Ra</em> creator Noelle Stevenson and the shifting mindsets surrounding LGBTQ+ representation. The show also offers diversity of ethnicity and body type, both of which are also sorely lacking in mainstream media.<br><br><a href="https://www.netflix.com/title/80179762"><u><strong>Stream She-Ra And The Princesses Of Power on Netflix.</strong></u></a><br><br>Hopefully, with all of these choices, you&apos;ll have plenty to watch in the near future, but you can also check out some of the <a href="https://www.cinemablend.com/streaming-news/2022-netflix-tv-show-premiere-dates"><u>2022 Netflix TV Shows</u></a> and <a href="https://www.cinemablend.com/streaming-news/2022-netflix-movie-release-dates"><u>Netflix Movies</u></a> for even more great titles. </p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ The Best Rami Malek Movies And TV Shows And How To Watch Them ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/streaming-news/the-best-rami-malek-movies-and-tv-shows-and-how-to-watch-them</link>
                                                                            <description>
                            <![CDATA[ Rami Malek has been making a name for himself in Hollywood for over a decade. Here are some of his best movies and TV shows so far. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">sK9CSFiZTsEbi6BYsGuhGk</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/MFrDoN3Sno3AAvY9rdCJSQ-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Sat, 07 May 2022 15:04:01 +0000</pubDate>                                                                                                                                <updated>Mon, 27 Oct 2025 09:35:43 +0000</updated>
                                                                                                                                            <category><![CDATA[Streaming News]]></category>
                                                                                                                    <dc:creator><![CDATA[ Alexandra Ramos ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/4vCq2c3J9ZiZUXQ3hPz69T.png ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Alexandra Ramos is a Content Producer at CinemaBlend. She first started off working in December 2020 as a Freelance Writer after graduating from the Pennsylvania State University with a degree in Journalism and a minor in English. She later moved over to full-time in July of 2021, and primarily works in features for movies, TV, and sometimes video games. She is also the main person who runs both our daily newsletter, The CinemaBlend Daily, and our ReelBlend newsletter that is sent out bi-weekly to patrons.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;
&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What She&#039;s Into&lt;/strong&gt;: Alex is into many things. She loves all kinds of movies except for super sappy romantic ones - with the only redeeming case being The Notebook, and is a big fantasy nerd. She’s a huge fan of the streaming shows that have been released, and loves to watch series’ like The Witcher, Shadow &amp;amp; Bone, and more. Her all-time favorite TV show has to be a solid three-way tie between Breaking Bad, Game of Thrones and Attack on Titan - she just can’t seem to pick one. Alex is also a big Marvel nerd, and will defend Scarlet Witch until her dying day. For years, she’s been an avid gamer, primarily for the PlayStation, and has become a part of the fanbase for games like The Last Of Us, God of War, Spider-Man, and more, but that won’t stop her from playing simple games like Animal Crossing, or FPS’ like Call of Duty. Alex is also a big sports fan and considers herself a couchside coach because she will threaten to throw stuff at her TV if Penn State or the NY Giants are losing (which is often), usually with pizza in her hands.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What She&#039;s Excited About Right Now&lt;/strong&gt;: The Boys Season 4 and its spinoff, Gen V Season 2, House of the Dragon Season 2, The Bear Season 4, Fallout, and Bridgerton Season 3 because I&#039;m missing my steamy romance.&amp;nbsp;&lt;/p&gt; ]]></dc:description>
                                                                                                                                <cf:isSponsored>false</cf:isSponsored>
                <cf:hasAffiliateLinks>false</cf:hasAffiliateLinks>
                <cf:isPaid>false</cf:isPaid>
                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/MFrDoN3Sno3AAvY9rdCJSQ-1280-80.jpg">
                                                            <media:credit><![CDATA[Twentieth Century Fox]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[Rami Malek performing as Freddie Mercury in Bohemian Rhapsody]]></media:description>                                                            <media:text><![CDATA[Rami Malek performing as Freddie Mercury in Bohemian Rhapsody]]></media:text>
                                <media:title type="plain"><![CDATA[Rami Malek performing as Freddie Mercury in Bohemian Rhapsody]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/MFrDoN3Sno3AAvY9rdCJSQ-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>Over time, a name that I’ve been seeing a lot more often in both movies and television is Rami Malek. From some of his first roles in film to his starring parts in huge hit TV shows, Malek has constantly proven how skilled of an actor he is. And if you’ve been wondering where to watch some of his best roles, you’re in exactly the right place. While there are some <a href="https://www.cinemablend.com/news/2494676/rami-malek-fascinating-things-to-know-about-the-bohemian-rhapsody-star"><u>awesome things to know about Rami Malek</u></a>, we’re here to talk about some of his best films. </p><p>If you’ve been on the lookout for the best Rami Malek movies and TV shows that are streaming or available to rent right now, this is the place for you, starting off with a huge hit of his. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="gV6hUPrtkQzJ5HeAJePuxK" name="MrRobot (1).jpg" alt="Rami Malek in Mr. Robot." src="https://cdn.mos.cms.futurecdn.net/gV6hUPrtkQzJ5HeAJePuxK.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: USA Network)</span></figcaption></figure><h2 id="mr-robot-2015-2019">Mr. Robot (2015 - 2019)</h2><p>You knew this one would be on the list. <em>Mr. Robot </em>is an awesome drama show telling the story of Elliot, a seemingly normal programmer who works as a cybersecurity engineer during the day, but at night, he turns into a hacker, acting as a vigilante to takedown a major corporation. </p><p>While Rami Malek worked prior to taking on the lead role in <em>Mr. Robot, </em>this was his breakout performance. His performance Elliot was well-loved and Malek received several accolades and nominations, showing just how amazing of an actor he truly is. It’s a shame the <a href="https://www.cinemablend.com/television/2481484/what-rami-malek-thinks-mr-robot-ending"><u>show had to come to an end,</u></a> but all good things do, and i don’t think we’ll ever quite forget our favorite hacker. </p><p><a href="https://www.amazon.com/gp/video/detail/B00YBX664Q/ref=atv_dp_share_cu_r"><u><strong>Stream Mr. Robot on Amazon Prime.</strong></u></a></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="qzAS75LsVRkszFPYN6xQHS" name="cred-alex-bailey-for-twentieth-c-fox_wide-0b9306aa3b0c130bb2782db974bd31e33db5687b-s1100-c50 (1).jpg" alt="Rami Malek in Bohemian Rhapsody." src="https://cdn.mos.cms.futurecdn.net/qzAS75LsVRkszFPYN6xQHS.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Twentieth Century Fox)</span></figcaption></figure><h2 id="bohemian-rhapsody-2018">Bohemian Rhapsody (2018)</h2><p>Freddie Mercury was one of my idols growing up, and Rami Malek was <em>stellar </em>as him in <em>Bohemian Rhapsody. </em>This biopic tells the story of Freddie Mercury and the band Queen, them becoming hitmakers overnight and him turning into the icon that he is now, as well as his personal struggles to get there. </p><p>Rami Malek actually won the Academy Award for Best Actor for his role in <em>Bohemian Rhapsody, </em>so if that wasn’t enough to get you to watch this film, I don’t know what is. He perfectly captures the essence that was Freddie Mercury and adds even more personality to the already iconic man. Truly, Rami Malek was amazing in this role. </p><p><a href="https://www.hbomax.com/ky/en/series/urn:hbo:series:GVU2wmQq7Go7DwvwIAVa7"><u><strong>Rent Bohemian Rhapsody on Amazon.</strong></u></a></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="9buixtMdGJgNSAMVUNCdN" name="article_full@3x (1).jpg" alt="Rami Malek in The Pacific." src="https://cdn.mos.cms.futurecdn.net/9buixtMdGJgNSAMVUNCdN.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: HBO)</span></figcaption></figure><h2 id="the-pacific-2010">The Pacific (2010)</h2><p>Next up, we have the miniseries, <em>The Pacific, </em>from HBO. This series based on the true stories of soldiers in WWII follows the U.S. Marines who were fighting against the Japanese during WWII, capturing their lives, struggles, and so much more. </p><p>For those who don’t know, HBO has made some really awesome shows, some of which include stories of WWII, including the legendary <em>Band of Brothers </em>that acts as a predecessor to this miniseries. Rami Malek was the perfect pick to play Cpl. Merriell “Snafu” Shelton, a character based on a real-life Marine, and Malek does him justice with his excellent acting performance alongside his co-stars. If <a href="https://www.cinemablend.com/news/2471978/the-7-best-and-most-realistic-war-movies"><u>realistic war movies</u></a> and movies about real-life situations are some of your favorite genres, you need to give this a shot, especially if you’re a fan of Malek, as he stands out amongst the rest. </p><p><a href="https://www.hbomax.com/ky/en/series/urn:hbo:series:GVU2wmQq7Go7DwvwIAVa7"><u><strong>Stream The Pacific on HBO Max.</strong></u></a></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="QTZZ7Rh9GZ2y6dg3oEjsbB" name="00130067 (1).jpg" alt="Rami Malek and Ben Stiller in Night at the Museum." src="https://cdn.mos.cms.futurecdn.net/QTZZ7Rh9GZ2y6dg3oEjsbB.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Twentieth Century Fox)</span></figcaption></figure><h2 id="night-at-the-museum-trilogy-2006-2014">Night At The Museum Trilogy (2006-2014)</h2><p>Ever wonder what would happen if a museum came to life at night? That’s what <em>Night at the Museum </em>is all about, mainly following the adventures of Larry Daley (<a href="https://www.cinemablend.com/movies/ben-stillers-best-movies-and-how-to-watch-them"><u>played by Ben Stiller</u></a>), a night shift security guard who ends up discovering that the American Museum of Natural History in New York comes to life at night. </p><p>Fun fact - the first <em>Night at the Museum</em> was actually Rami Malek’s first film ever, and what a movie to start out on, because he is <em>great </em>as Ahkmenrah, the owner of the tablet that allows the exhibits to come to life. I can’t get over how funny he is and his chemistry with Ben Stiller is super. While the film series is only a trilogy, Malek makes an appearance in each one, and further proves my hypothesis that he would make a great ancient pharaoh.</p><p><a href="https://www.disneyplus.com/movies/night-at-the-museum/7CIEBLbWIbTR"><u><strong>Stream The Night At The Museum Trilogy on Disney+.</strong></u></a><u><strong><br></strong></u><a href="https://www.amazon.com/gp/video/detail/B000PSGRSQ/ref=atv_dp_share_cu_r"><u><strong>Rent The Night At The Museum Trilogy on Amazon.</strong></u></a></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="aAUphtnKuesPMteG7mXieR" name="Screenshot (661).png" alt="Rami Malek in The Little Things." src="https://cdn.mos.cms.futurecdn.net/aAUphtnKuesPMteG7mXieR.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Warner Bros.)</span></figcaption></figure><h2 id="the-little-things-2021">The Little Things (2021)</h2><p>Next up, we have <em>The Little Things. </em>In this neo-noir crime film, Rami Malek stars as a detective alongside Denzel Washington, who are both on the case as a string of murders starts to connect to each other - all of which lead to them meeting a person that just might be the problem. </p><p>What really makes <em>The Little Things </em>one of Malek’s best movies is his chemistry with Denzel Washington. I love re-watching their scenes as detectives because you really believe that they’re actively trying to solve a case and show just how hard they are working. Even so, <em>The Little Things </em>is filled with great surprises, and you’ll find yourself twisting your head often just to keep up with all the changes in plot, making it a fun time. </p><p><a href="https://www.hbomax.com/rs/en/feature/urn:hbo:feature:GYA79hQZbUsI3gQEAAAB0"><u><strong>Stream The Little Things on HBO Max.</strong></u></a><u><strong><br></strong></u><a href="https://www.amazon.com/gp/video/detail/B091BDQ9G1/ref=atv_dp_share_cu_r"><u><strong>Rent The Little Things on Amazon.</strong></u></a></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="rSBomwiNQjju3SFpoox7bX" name="No Time To Die Rami Malek looks coolly towards the screen.jpg" alt="Rami Malek looks coolly towards the screen in No Time To Die." src="https://cdn.mos.cms.futurecdn.net/rSBomwiNQjju3SFpoox7bX.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Danjaq, LLC and MGM)</span></figcaption></figure><h2 id="no-time-to-die-2021">No Time To Die (2021)</h2><p>I’m sure at some point in 2021 you heard of <a href="https://www.cinemablend.com/movies/daniel-craigs-no-time-to-die-ending-was-in-the-works-a-lot-longer-than-you-might-guess"><u>Daniel Craig’s last James Bond film</u></a>, <em>No Time To Die. </em>In this film, we follow Bond, who is attempting to live out a normal life after retiring from MI6. But that retirement comes to a close when a former contact reaches out to him for help, pushing him back into the life of an international spy. </p><p>Rami Malek played a Bond villain in <em>No Time To Die, </em>Lyutsifer Safin, who is a terrorist and trying to get revenge on Spectre, and honestly, he plays the villain <em>really </em>well. Like, scarily well. Watching him in this Bond film makes me wonder why Malek doesn’t play more villains, because he surprisingly pulls it off and had some really amazing scenes with Craig. Rami Malek might have <a href="https://www.cinemablend.com/movies/no-time-to-dies-rami-malek-explains-how-he-fell-in-love-with-his-bond-villain"><u>fallen in love with his Bond villain</u></a><u>,</u> but I think I have, too. Someone help me. </p><p><a href="https://www.amazon.com/gp/video/detail/B09K1YRF44/ref=atv_dp_share_cu_r"><u><strong>Rent No Time To Die on Amazon.</strong></u></a></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="3X6mVToCq97yPNr4aVPAcd" name="5f99c4b2480cd8001c0e79f0 (1).png" alt="Rami Malek's character in BoJack Horseman." src="https://cdn.mos.cms.futurecdn.net/3X6mVToCq97yPNr4aVPAcd.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="bojack-horseman-2017-2018">BoJack Horseman (2017-2018)</h2><p>I bet you didn’t think you’d see a voice role on here. <em>BoJack Horseman </em>is an iconic <a href="https://www.cinemablend.com/streaming-news/the-best-animated-shows-on-netflix-right-now-for-adults"><u>adult animated series on Netflix</u></a><u>,</u> telling the story of the titular character who is trying to get back into the limelight after several years in obscurity by writing a tell-all novel using a ghost writer. </p><p>While Rami Malek has done voiceover work (as well as motion capture work) for video games before, like <em>Until Dawn </em>and <em>The Legend of Korra, </em>I wanted to point out his role as Flip McVicker, as I feel that’s some of his best voiceover work. His portrayal of the insecure yet pretentious creator of <em>Philbert </em>and the way he clashes with BoJack really makes the show during Seasons 4 and 5. I wish we had gotten to see more of him. </p><p><a href="https://www.netflix.com/title/70300800"><u><strong>Stream BoJack Horseman on Netflix.</strong></u></a></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="fnXmuGNa6SxTevSWEaj9bn" name="MV5BMTg0MjkyOTQzMV5BMl5BanBnXkFtZTgwMzYzOTM3MTI@._V1_ (1).jpg" alt="Rami Malek in Da Sweet Blood of Jesus." src="https://cdn.mos.cms.futurecdn.net/fnXmuGNa6SxTevSWEaj9bn.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Gravitas Ventures)</span></figcaption></figure><h2 id="da-sweet-blood-of-jesus-2014">Da Sweet Blood Of Jesus (2014)</h2><p>Next up, we have <em>Da Sweet Blood of Jesus. </em>This Spike Lee film tells the story of an anthropologist whose life changes when he is suddenly stabbed by a dagger, which turns out to be a magical weapon from ancient Africa that turns him into a terrifying creature - a vampire. </p><p>I know, the premise itself sounds like any old vampire film, but I have to say that <em>Da Sweet Blood of Jesus </em>is unique in every way. From how vampires work to the ending, that shows Rami Malek giving a compelling performance as Seneschal Higginbottom, working as a servant and having some really awesome scenes alongside Stephen Tyrion Williams as Dr. Green. It’s not your typical vampire film, but thanks to the brilliant acting from both Malek and his co-stars, it’s an intriguing entree into the fantasy genre. </p><p><a href="https://www.sho.com/titles/3418268/da-sweet-blood-of-jesus"><u><strong>Stream Da Sweet Blood of Jesus on Showtime.</strong></u></a><u><strong><br></strong></u><a href="https://tv.apple.com/us/movie/da-sweet-blood-of-jesus/umc.cmc.332ptm92awtys2yvfh7sq9shd?action=play"><u><strong>Rent Da Sweet Blood of Jesus on Apple TV.</strong></u></a></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="Kyv73nBmHarsMyhNLXkDgB" name="Screenshot (662).png" alt="Rami Malek in Papillon." src="https://cdn.mos.cms.futurecdn.net/Kyv73nBmHarsMyhNLXkDgB.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Bleecker Street)</span></figcaption></figure><h2 id="papillon-2017">Papillon (2017)</h2><p>Last but not least, we have <em>Papillon. </em>This biographical drama starring Charlie Hunnam and Rami Malek follows the true story of French convict Henri Charrière - who was called Papillon, and escaped with fellow convict, Louis Dega, from Devil’s Island in the 1940s. </p><p>The movie itself is really great, with a lot of thrilling action moments. But, what makes this movie one of Rami Malek’s best is his overall performance as Louis Dega, as well as his partnership with Charlie Hunnam as Henri Charrière. They truly make such an outstanding duo.</p><p><a href="https://www.hulu.com/movie/papillon-188055ef-ce49-4059-ab20-25c4d8bfe2cf"><u><strong>Stream Papillon on Hulu.</strong></u></a><u><strong><br></strong></u><a href="https://www.amazon.com/gp/video/detail/B07JMFBLVT/ref=atv_dp_share_cu_r"><u><strong>Rent Papillon on Amazon.</strong></u></a></p><p>Rami Malek is only going to continue to give us intriguing roles, considering he already has two films set to come out - one called <em>Amsterdam, </em>and the other is <a href="https://www.cinemablend.com/movies/oppenheimer-release-date-cast-and-other-things-we-know-about-the-christopher-nolan-movie"><u>Christopher Nolan’s </u><u><em>Oppenheimer</em></u></a><em>, </em>so you’re sure to see more of him. Until those release, enjoy some of his best films and TV shows now - you might just find a new favorite re-watch.  </p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ The Best Zach Braff Movies And Shows And How To Watch Them ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/streaming-news/the-best-zach-braff-movies-and-shows-and-how-to-watch-them</link>
                                                                            <description>
                            <![CDATA[ The list of the best Zach Braff movies and TV shows will surprise you, that's for sure. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">iEMwozSsttnh3qpBPVrs2d</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/4PqdSAHfJ5X8bycKVzQaWE-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Wed, 23 Mar 2022 11:04:11 +0000</pubDate>                                                                                                                                <updated>Mon, 27 Oct 2025 09:35:58 +0000</updated>
                                                                                                                                            <category><![CDATA[Streaming News]]></category>
                                                                                                                    <dc:creator><![CDATA[ Philip Sledge ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/EkAcyCb4XhyxmBbguSQhEX.jpg ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Philip Sledge is a content writer at CinemaBlend with a focus on longform features. He started writing for the website in December 2019, though his journey in journalism started years earlier. Writing gigs with school newspapers, multiple daily newspapers, and other varied job experiences led him to this point where he actually gets to write about movies, shows, wrestling, and documentaries (which is a huge win in his eyes).&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What He&#039;s Into&lt;/strong&gt;: As has been in the case for many years, Philip loves all things professional wrestling (especially early &#039;90s WCW and late-stage WCW if we&#039;re being honest). But outside of the squared circle, Philip is obsessed with all things George A. Romero as you can probably tell by the plethora of zombie stories he&#039;s written over the years. Documentaries, especially Frontline specials, are another passion for Philip, and he can often be heard going on and on about why everyone should watch some random doc about an obscure movie no one has ever seen before.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What He&#039;s Excited About Right Now&lt;/strong&gt;: Oppenheimer... so much so that his wife has asked him multiple times to stop talking about it (but he keeps doing it). He&#039;s also into Peacock&#039;s Twisted Metal series, which has rekindled his love of the classic vehicular combat video game. And since we&#039;re being all nostaglic, he&#039;s pumped to see Teenage Mutant Ninja Turtles: Mutant Mayhem.&lt;/p&gt; ]]></dc:description>
                                                                                                                                <cf:isSponsored>false</cf:isSponsored>
                <cf:hasAffiliateLinks>false</cf:hasAffiliateLinks>
                <cf:isPaid>false</cf:isPaid>
                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/4PqdSAHfJ5X8bycKVzQaWE-1280-80.jpg">
                                                            <media:credit><![CDATA[Fox Searchlight Pictures]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[Zach Braff in Garden State]]></media:description>                                                            <media:text><![CDATA[Zach Braff in Garden State]]></media:text>
                                <media:title type="plain"><![CDATA[Zach Braff in Garden State]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/4PqdSAHfJ5X8bycKVzQaWE-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>Whether he’s lost in some extravagant daydream, searching through “the infinite abyss,” or playing small yet unforgettable characters on a variety of sitcoms, Zach Braff has long been one of the most interesting and charming faces on the silver screen and small screen. Each time he steps into the frame, you can’t help but be carried away by his charm, comedic timing, and earnestness, which almost always makes for a fun experience.</p><p>And, with the former <a href="https://www.cinemablend.com/television/2548335/what-the-scrubs-cast-is-doing-now"><em>Scrubs</em> cast</a> member being a major part of the <a href="https://www.cinemablend.com/streaming-news/disneys-cheaper-by-the-dozen-cast-where-youve-seen-the-actors-before"><em>Cheaper by the Dozen</em> cast</a>, I started to think about the best Zach Braff movies and TV shows that I would like to revisit. In doing so, I found out that quite a few of them are streaming and thought to myself that others would be looking for the same, so I made this little list.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="7YDSvbhnYEe4croCqUgaDg" name="Scrubs .jpg" alt="Donald Faison and Zach Braff on Scrubs" src="https://cdn.mos.cms.futurecdn.net/7YDSvbhnYEe4croCqUgaDg.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="scrubs-2001-2010">Scrubs (2001 - 2010)</h2><p>Over the course of nine seasons, 182 episodes, and two networks, Zach Braff portrayed young doctor John “J.D.” Dorian at Sacred Heart Hospital on the critically acclaimed medical comedy, <em>Scrubs</em>. Throughout his run on the show (a run that turned him into a massive star), Braff’s character went from an awkward resident starting his career to a dependable mentor by the time things wrapped up, bringing laughs, tears, and <a href="https://www.cinemablend.com/television/2549038/scrubs-inside-jokes-that-are-still-brilliant">loads of inside jokes</a> along the way.</p><p>No matter what Braff does with his career from here on out, <em>Scrubs</em> will always be one of the shows for which he’s most remembered. One of <a href="https://www.cinemablend.com/television/2573046/ted-lasso-and-bill-lawrence-shows-and-how-to-watch-them-online">Bill Lawrence’s best creations</a>, this iconic early 2000s series wasn’t afraid to try new things, incorporate multiple genres, and give the cast room to breathe, creating some of TV’s best moments along the way.</p><p><a href="https://www.amazon.com/My-First-Day/dp/B003ZC9TXE"><strong>Stream Scrubs on Prime Video.</strong></a><strong><br></strong><a href="https://www.amazon.com/Scrubs-Complete-Seasons-Collection-Features/dp/B07PCSVDQT"><strong>Buy Scrubs on DVD/Blu-ray on Amazon.</strong></a></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="CHWBWD5KjpTnEy2GLWHqxW" name="garden state.jpg" alt="Natalie Portman and Zach Braff in Garden State" src="https://cdn.mos.cms.futurecdn.net/CHWBWD5KjpTnEy2GLWHqxW.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Disney / Fox)</span></figcaption></figure><h2 id="garden-state-2004">Garden State (2004)</h2><p>Following the sudden death of his mother, struggling actor Andrew Largeman (Zach Braff) returns to his New Jersey hometown for the funeral. But, what starts out as a quick trip home to honor his mother’s life quickly turns into an existential exploration of “the infinite abyss,” an odyssey that sees the despondent and heavily-medicated prodigal son cross paths an eccentric young woman named Samantha (Natalie Portman), who forever changes his life.</p><p>In addition to starring in <em>Garden State</em>, Zach Braff also wrote and directed this 2004 comedy-drama, and quickly made a name for himself as one of the most interesting young filmmakers in Hollywood. And, it doesn’t hurt that the movie has one of the best soundtracks in recent memory, which was hand-picked by Braff himself. </p><p><a href="https://www.hulu.com/movie/garden-state-cc2ef99b-31db-4d1d-8e45-094ddc7b40a5"><strong>Stream Garden State on Hulu.</strong></a><strong><br></strong><a href="https://www.amazon.com/Garden-State-Zach-Braff/dp/B000I9X6Q8"><strong>Rent/Buy Garden State on Amazon.</strong></a><strong><br></strong><a href="https://www.amazon.com/Garden-State-Blu-ray-Gary-Gilbert/dp/B00HI9QE9W"><strong>Buy Garden State on DVD/Blu-ray on Amazon.</strong></a></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="CHCLxk7oQDLDqwi2LdVu4B" name="Wish I Was Here.jpg" alt="The Wish I Was Here Cast" src="https://cdn.mos.cms.futurecdn.net/CHCLxk7oQDLDqwi2LdVu4B.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Focus Feature)</span></figcaption></figure><h2 id="wish-i-was-here-2014">Wish I Was Here (2014)</h2><p>Aidan Bloom (Zach Braff) is forced to pull his children out of an expensive private school after his father, who pays for their schooling, is diagnosed with cancer and decides to spend the last of his money on a revolutionary treatment. Instead of finding a new school, however, Aidan decides to homeschool his daughter and son by following a rather unorthodox curriculum that involves camping, swimming, and San Diego Comic-Con.</p><p>Zach Braff’s character in the <a href="https://www.cinemablend.com/new/Zach-Braff-Kickstarting-His-Garden-State-Follow-Up-Wish-I-Was-Here-37146.html">Kickstarter-funded <em>Wish I Was Here</em></a> is one of the most endearing of his career and goes through a tremendous change by the time the movie ends. The way Braff, who also co-wrote and directed the 2014 comedy, portrays a father forced to sacrifice his own desires for those of his children makes for a great study of parenthood and being an adult in general.</p><p><a href="https://www.amazon.com/Wish-Was-Here-Zach-Braff/dp/B00OYWHKVC"><strong>Stream Wish I Was Here on IMDbTV.</strong></a><strong><br></strong><a href="https://www.amazon.com/Wish-Was-Here-Zach-Braff/dp/B00OYWHKVC"><strong>Rent/Buy Wish I Was Here on Amazon.</strong></a><strong><br></strong><a href="https://www.amazon.com/Wish-I-Was-Here-dvd/dp/B00MI0T6GY"><strong>Buy Wish I Was Here on DVD/Blu-ray on Amazon.</strong></a></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="ds5g6nzvY2sY2rChmX3qjN" name="Chicken Little.jpg" alt="Chicken Little in Chicken Little" src="https://cdn.mos.cms.futurecdn.net/ds5g6nzvY2sY2rChmX3qjN.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Buena Vista Pictures Distribution)</span></figcaption></figure><h2 id="chicken-little-2005">Chicken Little (2005)</h2><p>After claiming the sky is falling and the end is near, Chicken Little (Zach Braff) is viewed upon as the “boy who cried wolf” and untrustworthy for getting his town all worked up in a state of panic. But, when it happens a second time, things are worse than they appear, and only the small, outcast chicken can save the day from arriving extraterrestrial invaders.</p><p>Based on the classic European folk tale of the same name, the 2005 animated film, <em>Chicken Little,</em> captures the heart and soul of the source material while also transitioning it into modernity. All of the actors are amazing in their respective roles throughout the movie, but none compare to the kind nature of the underdog Chicken Little, who is made all the more likable thanks to Zach Braff’s understanding of the role.</p><p><a href="https://www.disneyplus.com/movies/chicken-little/4xcV4EkW6b37"><strong>Stream Chicken Little on Disney+.</strong></a><strong><br></strong><a href="https://www.amazon.com/Chicken-Little-voices/dp/B0060CRM6M"><strong>Rent/Buy Chicken Little on Amazon.</strong></a><strong><br></strong><a href="https://www.amazon.com/Chicken-Little-Blu-ray-Zach-Braff/dp/B000MQ58VI"><strong>Buy Chicken Little on DVD/Blu-ray on Amazon.</strong></a></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="MUdi6xgYS28ekCpwVZndX4" name="The Ex.jpg" alt="Zach Braff in The Ex" src="https://cdn.mos.cms.futurecdn.net/MUdi6xgYS28ekCpwVZndX4.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Metro-Goldwyn-Mayer)</span></figcaption></figure><h2 id="the-ex-2006">The Ex (2006)</h2><p>On the eve of becoming a father, Tom Reilly (Zach Braff) takes a job at his father-in-law’s advertising agency where he soon strikes up a bitter rivalry with his wife’s ex-boyfriend, Chip Sanders (Jason Bateman), who uses his brain and paraplegic state against him.</p><p>Probably one of the funniest movies of 2006, <em>The Ex</em> is held together by the on-screen chemistry of Zach Braff and Jason Bateman, who do such an amazing job of portraying two bitter rivals that you believe they actually hate one another. The constant back-and-forth between the two as they jockey for position is incredible and really increases the drama and comedy.</p><p><a href="https://pluto.tv/en/search/details/movies/ex-the-2006-2007-1-1"><strong>Stream The Ex on Pluto TV.</strong></a><strong><br></strong><a href="https://www.amazon.com/Ex-Unrated-Zach-Braff/dp/B002QNBRX8"><strong>Rent/Buy The Ex on Amazon.</strong></a></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="f2CEoKKwD9pWf9wcWZ97JH" name="The Last Kiss.jpg" alt="Rachel Bilson and Zach Braff in The Last Kiss" src="https://cdn.mos.cms.futurecdn.net/f2CEoKKwD9pWf9wcWZ97JH.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: DreamWorks Pictures)</span></figcaption></figure><h2 id="the-last-kiss-2006">The Last Kiss (2006)</h2><p>Michael (Zach Braff) seems to have everything going for him in life: he has a loving girlfriend who is pregnant with their first child, a well-paying job, and a group of close friends. Despite that, the soon-to-be 30-year-old feels trapped and nothing like the free young man he used to be. When he meets a young college student named Kim (Rachel Bilson) at a wedding, Michael sees a quick escape, but his new fling could bring his life crashing down.</p><p>Tony Goldwyn’s 2006 romantic drama <em>The Last Kiss</em> (a remake of the Italian film <em>L’Ultimo Bacio</em>) shows a Zach Braff character who is far different from anything he had played before. Sure, his characters have always been a bit complicated and introspective, but his portrayal of Michael in his fall from grace is truly something else. It’s strange, because you are forced to decide whether or not you like the character or despise him for his actions, and mistakes, in life.</p><p><a href="https://www.amazon.com/Last-Kiss-Zach-Braff/dp/B015SEPQSS/"><strong>Rent/Buy The Last Kiss on Amazon.</strong></a><strong><br></strong><a href="https://www.amazon.com/Last-Kiss-Blu-ray-Zach-Braff/dp/B074J4TLXB"><strong>Buy The Last Kiss on DVD/Blu-ray on Amazon.</strong></a></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="iPzRNVMbb5nB2JP4uJEGjC" name="Manhattan Murder Mystery.jpg" alt="The Manhattan Murder Mystery cast" src="https://cdn.mos.cms.futurecdn.net/iPzRNVMbb5nB2JP4uJEGjC.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Tri Star Pictures)</span></figcaption></figure><h2 id="manhattan-murder-mystery-1993">Manhattan Murder Mystery (1993)</h2><p>When one of their neighbors suddenly dies, Larry Lipton (Woody Allen) and his wife Carol (Diane Keaton) find themselves so intrigued by the mystery they begin investigating the matter on their own, no matter what they might encounter on their curious journey into the unknown.</p><p>Although Zach Braff only appears briefly in <em>Manhattan Murder Mystery</em> as Larry and Carol’s son, Nick Lipton, it’s a performance that should be brought up at every opportunity. This is mostly due to the fact that this Braff’s feature film debut (he had appeared on an episode of <em>The Baby-Sitters Club</em> at this point), which automatically makes it more intriguing. </p><p><a href="https://www.amazon.com/Manhattan-Murder-Mystery-Alan-Alda/dp/B00ACY8S30/"><strong>Rent/Buy Manhattan Murder Mystery on Amazon.</strong></a><strong><br></strong><a href="https://www.amazon.com/Manhattan-Murder-Mystery-DVD/dp/B08WSRV8M5/"><strong>Buy Manhattan Murder Mystery on DVD/Blu-ray on Amazon. </strong></a></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="on6dwn5cYpbcWAsshoZqCo" name="BoJack Horseman.jpg" alt="Zach Braff on BoJack Horseman" src="https://cdn.mos.cms.futurecdn.net/on6dwn5cYpbcWAsshoZqCo.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="bojack-horseman-2017-2020">BoJack Horseman (2017, 2020)</h2><p>One of the best Netflix original series, the animated adult comedy, <em>BoJack Horseman,</em> centers on the titular washed-up actor (Will Arnett) as he struggles to find meaning in life now that he’s no longer the star of the popular <em>Horsin’ Around</em> sitcom. Over the course of six seasons, the walking, talking, anthropomorphic horse deals with depression, fame, and what it means to be successful in Hollywood.</p><p>There were a ton of great celebrity cameos throughout <em>BoJack Horseman</em>’s run on Netflix, including an <a href="https://www.cinemablend.com/movies/great-weird-al-yankovic-appearances-in-movies-and-tv-shows">appearance by Weird Al Yankovic</a> at one point. Well, you can add Zach Braff to the list of famous actors who popped up on the show on two occasions, first at a Season 4 party where he caught on fire and was killed by Jessica Biel and then again in the final season in one of BoJack’s dreams. The best part about his appearances was the way Braff parodied himself, especially with his comments about monologues.</p><p><a href="https://www.netflix.com/title/70300800"><strong>Stream BoJack Horseman on Netflix.</strong></a></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="EXHyM9uRV2otX6ihfEp5j6" name="Arrested Development.jpg" alt="Zach Braff on Arrested Development" src="https://cdn.mos.cms.futurecdn.net/EXHyM9uRV2otX6ihfEp5j6.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Fox)</span></figcaption></figure><h2 id="arrested-development-2005-2006">Arrested Development (2005 - 2006)</h2><p>One of the funniest shows of the 21st Century, <em>Arrested Development</em> followed the lives and exploits of the Bluth family. Over the course of <a href="https://www.cinemablend.com/television/2460364/arrested-development-will-probably-be-cancelled-on-netflix-after-season-5">five seasons</a> (the first three on Fox, the later two as a Netflix revival), the family, to the chagrin of Michael Bluth (Jason Bateman), found themselves in one ridiculous situation after another in the wake of the family patriarch, George Bluth Sr. (Jeffrey Tambor), going to prison.</p><p>In addition to the large Bluth family, <em>Arrested Development</em> also featured an even more expansive cast of supporting characters like Zach Braff’s Phillip Litt, an unsavory filmmaker behind the exploitative <em>Girls with Low Self-Esteem</em> video series. This character is completely over-the-top and nothing like anything else Braff had done up to that point or since. Clearly a parody of <em>Girls Gone Wild</em> creator Joe Francis, Braff appears to be having a lot of fun with the portrayal.</p><p><a href="https://www.netflix.com/title/70140358"><strong>Stream Arrested Development on Netflix.</strong></a><strong><br></strong><a href="https://www.amazon.com/Top-Banana/dp/B006IWJAXM"><strong>Buy Arrested Development on Amazon.</strong></a><strong><br></strong><a href="https://www.amazon.com/Arrested-Development-Seasons-Jason-Bateman/dp/B00JQYUWSG"><strong>Buy Arrested Development on DVD/Blu-ray on Amazon.</strong></a></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="5GJexvpC75UZkGaC6LBbo" name="The High Cost of Living.jpg" alt="Isabelle Blais  and Zach Braff in The High Cost of Living" src="https://cdn.mos.cms.futurecdn.net/5GJexvpC75UZkGaC6LBbo.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Tribeca Film)</span></figcaption></figure><h2 id="the-high-cost-of-living-2010">The High Cost Of Living (2010)</h2><p>When a hit-and-run accident results in the death of her unborn child, Nathalie (Isabelle Blais) falls into a downward spiral of depression and lost hope. That all changes when she meets an equally flawed man named Henry (Zach Braff), who’s own decisions in life have left him in a situation just as dark and dreadful. Together, they form a strong bond that is put to its ultimate test with a devastating revelation.</p><p>Before Deborah Chow went on to direct <a href="https://www.cinemablend.com/television/2565259/obi-wan-kenobi-disney-tv-show-quick-things-we-know-about-the-star-wars-series">the upcoming <em>Obi-Wan Kenobi</em> series</a> on Disney+, she cut her teeth with intimate indie projects like 2010’s <em>The High Cost of Living</em>. Far more toned-down from Braff’s work on <em>Scrubs</em>, this small project really gives him a lot of room to try out a different character, one far less upbeat than J.D., and it works really well.</p><p><a href="https://www.peacocktv.com/watch/asset/movies/drama/the-high-cost-of-living/c469f42c-4b5d-3500-88ed-1d7c66924b42"><strong>Stream The High Cost of Living on Peacock.</strong></a><strong><br></strong><a href="https://www.amazon.com/High-Cost-Living-Zach-Braff/dp/B084C4Q6WW"><strong>Rent/Buy The High Cost of Living on Amazon.</strong></a><strong><br></strong><a href="https://www.amazon.com/High-Cost-Living-Zach-Braff/dp/B004WCSMGQ"><strong>Buy The High Cost of Living on DVD/Blu-ray on Amazon.</strong></a></p><p>With multiple movies coming out in the very near future, expect on seeing some additions to this list of the best Zach Braff movies and TV shows. If you want more information on those projects, take a look at CinemaBlend&apos;s list of all the <a href="https://www.cinemablend.com/news/2569630/2022-new-movie-release-dates-full-schedule-of-all-the-upcoming-movies">2022 movie releases</a> so you don&apos;t miss a thing. </p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ 9 Great Weird Al Yankovic Appearances In Movies And TV Shows  ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/movies/great-weird-al-yankovic-appearances-in-movies-and-tv-shows</link>
                                                                            <description>
                            <![CDATA[ Do you remember these hilarious cameos by "Weird Al" Yankovic in movies and TV shows? ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">k5hJknhCU4pkkHZC3GxgKn</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/qj6zdZfHDCyzLR3qtpfBdj-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Sat, 05 Mar 2022 01:04:06 +0000</pubDate>                                                                                                                                                                                                                                <category><![CDATA[Movies]]></category>
                                                                                                                    <dc:creator><![CDATA[ Jason Wiese ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/62SRu9Bi2SyJGrpzKXAfsK.jpg ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Jason Wiese writes feature stories for CinemaBlend. His occupation results from years dreaming of a filmmaking career, settling on a &quot;professional film fan&quot; career, studying journalism at Lindenwood University in St. Charles, MO (where he served as Culture Editor for its student-run print and online publications), and a brief stint of reviewing movies for fun. He would later continue that side-hustle of film criticism on TikTok (@wiesewisdom), where he posts videos on a semi-weekly basis.&lt;/p&gt;&lt;p&gt;&lt;br&gt;&lt;/p&gt;&lt;p&gt;Jason has been writing since he was able to pick up a washable marker, with which he wrote his debut illustrated children&#039;s story, later transitioning to a short-lived comic book series and (very) amateur filmmaking before finally settling on pursuing a career in writing about movies in lieu of making them. Look for his name in almost any article about Batman.&lt;/p&gt;&lt;p&gt;&lt;br&gt;&lt;/p&gt;&lt;p&gt;&lt;strong&gt;What He&#039;s Into&lt;/strong&gt;: Readers may notice a recurring theme of horror and superhero-related content (especially in regards to Batman) in much of Jason&#039;s work, but his favorite film of all time is more in line with traditional action/adventure stories: &lt;em&gt;Raiders of the Lost Ark&lt;/em&gt;. His favorite TV series is the gritty, grounded crime thriller &lt;em&gt;Breaking Bad&lt;/em&gt; and if you catching him reading anything, it is probably a comic book (and, more often than not, one featuring Batman). More important to him than entertainment, however, are his wife and two dogs.&lt;/p&gt;&lt;p&gt;&lt;br&gt;&lt;/p&gt;&lt;p&gt;&lt;strong&gt;What He&#039;s Excited About Right Now&lt;/strong&gt;: Jason typically tries to keep his excitement and expectations for any upcoming movies as low as possible, but he is certainly looking forward to returning to Matt Reeves&#039; vision of Gotham City in the upcoming follow-up to &lt;em&gt;The Batman&lt;/em&gt; and just about any horror movie set to haunt cinemas soon.&lt;/p&gt; ]]></dc:description>
                                                                                                                                <cf:isSponsored>false</cf:isSponsored>
                <cf:hasAffiliateLinks>false</cf:hasAffiliateLinks>
                <cf:isPaid>false</cf:isPaid>
                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/qj6zdZfHDCyzLR3qtpfBdj-1280-80.jpg">
                                                            <media:credit><![CDATA[Paramount Pictures]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[Weird Al Yankovic in The Naked Gun: From the Files of Police Squad!]]></media:description>                                                            <media:text><![CDATA[Weird Al Yankovic in The Naked Gun: From the Files of Police Squad!]]></media:text>
                                <media:title type="plain"><![CDATA[Weird Al Yankovic in The Naked Gun: From the Files of Police Squad!]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/qj6zdZfHDCyzLR3qtpfBdj-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>The undisputed king of musical comedy and parody songs is getting his own biopic and the casting choice is amazing. Former <em>Harry Potter</em> star <a href="https://www.cinemablend.com/streaming-news/first-official-look-at-daniel-radcliffe-as-weird-al-yankovic-is-here-and-i-hope-the-director-approves">Daniel Radcliffe is playing “Weird Al” Yankovic</a> in the upcoming Roku Channel original movie <em>WEIRD: The Weird Al Story</em>, which itself is a feature-length adaptation of a fake trailer released by Funny Or Die in 2010.</p><p>The stellar news reminds of some of the notable “Weird Al” Yankovic movies and TV shows in which the musician was the star - like the 1989 TV industry parody <em>UHF</em> (which he also co-wrote), or the short-lived children’s program <em>The Weird Al Show</em> from the late ‘90s, or when he <a href="https://www.cinemablend.com/television/Weird-Al-Yankovic-Returning-TV-Get-Details-113657.html">became the bandleader</a> for <em>Comedy Bang! Bang!</em> However, what I would rather talk about right now are the funniest and most memorable times he made a surprise cameo in a movie or had a smaller guest or recurring spot on a TV show. For instance…</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="HVqiXgMwbV5HTu6RLmoRzR" name="weird al 2.jpg" alt="Weird Al Yankovic in The Naked Gun 2-1/2: The Smell of Fear" src="https://cdn.mos.cms.futurecdn.net/HVqiXgMwbV5HTu6RLmoRzR.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Paramount)</span></figcaption></figure><h2 id="the-naked-gun-movies-1988-1994">The Naked Gun Movies (1988-1994)</h2><p>One of “Weird Al” Yankovic’s first movie appearances was in the brilliant detective spoof <em>The Naked Gun: From the Files of Police Squad!</em>, in which the <a href="https://www.cinemablend.com/new/Leslie-Nielsen-Dead-84-21912.html">late, great Leslie Nielsen</a>’s Lt. Frank Drebin believes reporters waiting to see the musician <a href="https://www.youtube.com/watch?v=Cqg-YZhr3bA">really want his interview</a> outside an airport. Yankovic also showed up in the 1991 sequel, <em>The Naked Gun 2-1/2: The Smell of Fear</em>, as a thug whose police station hold up is <a href="https://www.youtube.com/watch?v=wWqHzq8ufVM">unwittingly stopped by Frank</a> simply opening a door. “Weird Al” played himself again in <em>The Naked Gun 3-1/3: The Final Insult</em>, in which Frank and his wife, Jane (Priscilla Presley), pose as the comic and his date, Vanna White, to get into the Oscars.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="HUiyXoGPScVNMcohxx88Q6" name="weird al spy.jpg" alt="Weird Al Yankovic in Spy Hard" src="https://cdn.mos.cms.futurecdn.net/HUiyXoGPScVNMcohxx88Q6.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Hollywood Pictures)</span></figcaption></figure><h2 id="spy-hard-1996">Spy Hard (1996)</h2><p>“Weird Al” Yankovic was also involved in Leslie Nielsen’s espionage thriller parody, <em>Spy Hard</em> - in which the comedy legend plays a <a href="https://www.cinemablend.com/new/10-Movie-Spies-Were-Really-Really-Bad-Their-Jobs-88067.html">bumbling secret named Dick Steele</a> (seriously) - but with more than a seconds-long cameo this time. Al appears throughout the extremely cartoonish film’s <a href="https://www.youtube.com/watch?v=F7KMMxAQp8I">James Bond-style opening credits sequence</a>, which essentially serves as the music video for the self-referential theme song that he writes and performs.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="rSKDaAmPBq4N4ZQ6y3iNg4" name="weird al halloween.jpg" alt="Weird Al Yankovic, Malcolm McDowell, and Chris HardwickHalloween II" src="https://cdn.mos.cms.futurecdn.net/rSKDaAmPBq4N4ZQ6y3iNg4.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Dimension)</span></figcaption></figure><h2 id="halloween-ii-2009">Halloween II (2009)</h2><p>Sadly, “Weird Al” Yankovic does not perform any music in director Rob Zombie’s <a href="https://www.cinemablend.com/news/2480225/rob-zombie-calls-working-on-his-halloween-movies-a-miserable-experience">sequel to his brutal, 2007 <em>Halloween</em> remake</a>, but does provide what is easily the film’s funniest moment while appearing on a talk show with Malcolm McDowell’s Dr. Samuel Loomis. When host David Newman (Chris Hardwick) asks the psychologist - promoting his new book about Michael Myers (Tyler Mane) - about accusations of “profiteering off the misery of others,” the musician jokingly interjects, as if assuming the question was about his own song parodies. Loomis, however, does not find it very funny and later scolds his publicist over the embarrassment. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="NxuKoNXfVcu6tRkiPvrnFR" name="weird al crazy.jpg" alt="Weird Al Yankovic on Crazy Ex-Girflriend" src="https://cdn.mos.cms.futurecdn.net/NxuKoNXfVcu6tRkiPvrnFR.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: The CW)</span></figcaption></figure><h2 id="crazy-ex-girlfriend-2019">Crazy Ex-Girlfriend (2019)</h2><p>“Weird Al” Yankovic did, thankfully, play music on a TV series that already welcomed such performances regularly and <a href="https://www.cinemablend.com/television/Why-Jane-Virgin-Crazy-Ex-Girlfriend-Really-Needed-Awards-Nods-104597.html">won multiple Emmy Awards</a> for it. On a Season 4 episode of <em>Crazy Ex-Girlfriend</em>, Greg (Skyler Astin) wants to go all out for his date with Rebecca (star and co-creator Rachel Bloom) and books a hot air balloon ride for the two of them from Bernie (Yankovic). After setting up the appointment, the top-hat wearing clerk gives the gentleman a “word of warning” about there being no way to use the restroom in a hot air balloon <a href="https://www.youtube.com/watch?v=DHQtsgDLwls">with a serenade</a> that uses “Weird Al’s” signature instrument: the accordion.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="Av2yCnq4urZDhsMdqj6NfZ" name="weird al himym.jpg" alt="Weird Al Yankovic on How I Met Your Mother" src="https://cdn.mos.cms.futurecdn.net/Av2yCnq4urZDhsMdqj6NfZ.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: CBS)</span></figcaption></figure><h2 id="how-i-met-your-mother-2011">How I Met Your Mother (2011)</h2><p>In a Season 7 episode of <em>How I Met Your Mother</em>, Ted Mosby (Josh Radnor) tries to find someone to accompany him to a “Weird Al” Yankovic concert. He also claims that he gave the parodist the idea for his 1985 hit “Like a Surgeon,” which borrows from the tune of Madonna’s “Like a Virgin.” The rest of the <a href="https://www.cinemablend.com/television/2474932/how-i-met-your-mother-whats-the-cast-up-to-now"><em>HIMYM</em> cast</a> assume this to be a fantasy, until a flashback at the end of the episode featuring “Weird Al” as himself circa 1985 confirms that it was Ted’s fan letter that led to the song’s existence.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="eFyQ34f8fgiKwDb77dJj8n" name="weird al simpsons.jpg" alt="Weird Al Yankovic on The Simpsons" src="https://cdn.mos.cms.futurecdn.net/eFyQ34f8fgiKwDb77dJj8n.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Disney)</span></figcaption></figure><h2 id="the-simpsons-2003-2008">The Simpsons (2003-2008)</h2><p>There have been many amazing celebrity guests on <em>The Simpsons</em> and “Weird Al” Yankovic is one of a few who has leant his voice to Matt Groening’s seminal animated series as himself twice, so far. The first was a Season 14 episode in which a heartbreaking revelation forces Homer to leave his family, so <a href="https://www.youtube.com/watch?v=BqD2KF5Bg7k">Marge enlists Al’s help</a> with a parody of John Mellencamp’s “Jack & Diane” called “Homer & Marge.” The second time, in Season 19, he performed a parody of a song by Homer’s own band, Sandgasm - which, itself, is a parody of Nirvana. <em>Parodyception?</em></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="7k6vgPovjJ5iHRgyqfPNUA" name="weird al bojack.jpg" alt="Will Arnett and Weird Al Yankovic on BoJack Horseman" src="https://cdn.mos.cms.futurecdn.net/7k6vgPovjJ5iHRgyqfPNUA.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="bojack-horseman-2016-2019">BoJack Horseman (2016-2019)</h2><p>On some rare occasions, “Weird Al” Yankovic has also leant his voice to a few animated characters that are not just fictionalized versions of himself. One of the more notable examples is when he appeared on Season 3 of Netflix’s <em>BoJack Horseman</em> as Captain Peanutbutter - the brother of Paul F. Thompkins’ Mr. Peanutbutter - who would become a recurring character, appearing in two more episodes in Season 6. It was actually executive producer and series regular Aaron Paul who <a href="https://www.youtube.com/watch?v=VGxxZyKteYM&t=0s">helped get Yankovic on the show</a>, bringing his performance as the musician in <a href="https://www.youtube.com/watch?v=vcNuiri2dV0">the aforementioned Funny Or Die sketch</a> full circle.</p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="SsFLUo8AyN4vE2tmLgWcYQ" name="weird al darkseid.jpg" alt="Weird Al Yankovic as Darkseid on Teen Titans Go!" src="https://cdn.mos.cms.futurecdn.net/SsFLUo8AyN4vE2tmLgWcYQ.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Warner Bros.)</span></figcaption></figure><h2 id="teen-titans-go-2015-2018-xa0">Teen Titans Go! (2015-2018) </h2><p>One of the more unexpected instances of “Weird Al” Yankovic playing an animated character is the multiple times he leant his voice to <em>Teen Titans Go!</em> as Darkseid - yes, the same ruthless, tyrannical god who appeared in <em>Zack Snyder’s Justice League</em> as played by Ray Porter. Speaking of the Justice League, in an episode in which the young heroes pose as their adult peers to save them from the villain, Cyborg (Phil LaMarr) - in a Green Lantern costume - <a href="https://www.youtube.com/watch?v=DoZ9C9_TTQM">points out his vocal resemblance</a> to the musical comedian. Darkseid quips that even he is not as evil as someone who makes a living “making songwriters look like fools,” which is actually what leads to their epic standoff. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="VZq9nmhWfPri2XvjkSJEKe" name="weird al bill.jpg" alt="Weird Al Yankovic in Bill and Ted Face the Music" src="https://cdn.mos.cms.futurecdn.net/VZq9nmhWfPri2XvjkSJEKe.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: United Artists)</span></figcaption></figure><h2 id="bill-and-ted-face-the-music-2020-xa0">Bill And Ted Face The Music (2020) </h2><p>A more recent “Weird Al” Yankovic cameo that you might have already forgotten, or maybe even failed to catch in the first place, was in <em>Bill and Ted Face the Music</em> - the long-awaited third installment of the sci-fi comedy franchise starring Keanu Reeves and Alex Winter. The blink-and-you-miss-it appearance occurs during the film’s ending credits as part of a compilation of musicians jamming to the soundtrack. Yankovic posted the brief clip to his <a href="https://www.instagram.com/p/CEcY7-Qlmmb/?utm_source=ig_web_button_share_sheet">Instagram</a> with a mention that this cameo was not a paid gig, but the result of a contest to appear in the film that he, a fan of <a href="https://www.cinemablend.com/news/2550720/things-to-remember-from-the-bill-and-ted-movies-before-bill-and-ted-face-the-music">the original movies</a>, entered for fun.</p><p>We have barely scratched the surface of all the fittingly weird “Weird Al” Yankovic appearances to look out for the big and small screen, but these are our favorites. What are yours?</p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ 11 Hilarious Dark Comedy TV Shows And How To Watch Them ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/streaming-news/hilarious-dark-comedy-tv-shows-and-how-to-watch-them</link>
                                                                            <description>
                            <![CDATA[ Dark comedies are some of the best shows out there. Here are some of the best one that you can stream right now online, including Dead to Me. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">iPNy5rTcB3aS2SkQuKaPyY</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/R2gVTy9T4FBBXKkBxsQpqF-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Wed, 19 Jan 2022 21:04:49 +0000</pubDate>                                                                                                                                <updated>Mon, 27 Oct 2025 09:35:58 +0000</updated>
                                                                                                                                            <category><![CDATA[Streaming News]]></category>
                                                                                                                    <dc:creator><![CDATA[ Alexandra Ramos ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/4vCq2c3J9ZiZUXQ3hPz69T.png ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Alexandra Ramos is a Content Producer at CinemaBlend. She first started off working in December 2020 as a Freelance Writer after graduating from the Pennsylvania State University with a degree in Journalism and a minor in English. She later moved over to full-time in July of 2021, and primarily works in features for movies, TV, and sometimes video games. She is also the main person who runs both our daily newsletter, The CinemaBlend Daily, and our ReelBlend newsletter that is sent out bi-weekly to patrons.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;
&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What She&#039;s Into&lt;/strong&gt;: Alex is into many things. She loves all kinds of movies except for super sappy romantic ones - with the only redeeming case being The Notebook, and is a big fantasy nerd. She’s a huge fan of the streaming shows that have been released, and loves to watch series’ like The Witcher, Shadow &amp;amp; Bone, and more. Her all-time favorite TV show has to be a solid three-way tie between Breaking Bad, Game of Thrones and Attack on Titan - she just can’t seem to pick one. Alex is also a big Marvel nerd, and will defend Scarlet Witch until her dying day. For years, she’s been an avid gamer, primarily for the PlayStation, and has become a part of the fanbase for games like The Last Of Us, God of War, Spider-Man, and more, but that won’t stop her from playing simple games like Animal Crossing, or FPS’ like Call of Duty. Alex is also a big sports fan and considers herself a couchside coach because she will threaten to throw stuff at her TV if Penn State or the NY Giants are losing (which is often), usually with pizza in her hands.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What She&#039;s Excited About Right Now&lt;/strong&gt;: The Boys Season 4 and its spinoff, Gen V Season 2, House of the Dragon Season 2, The Bear Season 4, Fallout, and Bridgerton Season 3 because I&#039;m missing my steamy romance.&amp;nbsp;&lt;/p&gt; ]]></dc:description>
                                                                                                                                <cf:isSponsored>false</cf:isSponsored>
                <cf:hasAffiliateLinks>false</cf:hasAffiliateLinks>
                <cf:isPaid>false</cf:isPaid>
                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/R2gVTy9T4FBBXKkBxsQpqF-1280-80.jpg">
                                                            <media:credit><![CDATA[Netflix]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[Linda Cardellini and Christina Applegate on Dead To Me]]></media:description>                                                            <media:text><![CDATA[Linda Cardellini and Christina Applegate on Dead To Me]]></media:text>
                                <media:title type="plain"><![CDATA[Linda Cardellini and Christina Applegate on Dead To Me]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/R2gVTy9T4FBBXKkBxsQpqF-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>Dark comedies have certainly blown up in recent years as some of the go-to shows for fans of hilarious bits with a bit of dark humor. Or, perhaps just the whole entire show revolving around a dark purpose. Streaming platforms from all over have come up with some awesome ideas, hysterical moments and so much more that they have truly become hits. </p><p>Shows like <em>Dead to Me, Barry </em>or even <em>The Boys </em>have become so popular that today, we’re going to do a dedicated article just for them. So, if you’re looking for some of the best dark comedy TV shows, be sure to check these picks out. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="M9RHYNuiYcwfM9aukNveem" name="Dead-to-Me-1280x720.jpg" alt="Christina Applegate and Linda Cardellini in Dead to Me." src="https://cdn.mos.cms.futurecdn.net/M9RHYNuiYcwfM9aukNveem.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="dead-to-me-netflix">Dead To Me (Netflix)</h2><p>In this Netflix original show, <em>Dead to Me </em>tells the story of two women who have both gone through horrible losses, both losing their husbands and having to learn how to live with their grief through grief counseling. However, one of them is hiding the secret of a lifetime - and it’ll be huge if this secret gets out. </p><p><em>Dead to Me </em>is one those shows where at first, it may be a little slow to start, but after the first episode, you’ll be drawn in to watch every single episode afterwards. Both <a href="https://parade.com/1031053/nicolepajer/dead-to-me-christina-applegate-linda-cardellini/"><u>Christina Applegate and Linda Cardellini are brilliant</u></a> in their leading roles and have such amazing chemistry, paired with a story that’s enthralling from start to end. </p><p><a href="https://www.netflix.com/title/80219707"><u><strong>Stream Dead to Me on Netflix.</strong></u></a></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="HRiMD3u5mH2z3LiqjH2rnC" name="Fi-T-Top10-Its-Always-Sunny-In-Philadelphia-Moments-720p30.jpg" alt="The main cast of It's Always Sunny in Philadelphia." src="https://cdn.mos.cms.futurecdn.net/HRiMD3u5mH2z3LiqjH2rnC.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: FXX)</span></figcaption></figure><h2 id="it-x2019-s-always-sunny-in-philadelphia-hulu">It’s Always Sunny In Philadelphia (Hulu)</h2><p>I’m sure at some point you’ve heard of this show. <em>It’s Always Sunny in Philadelphia </em>is a dark comedy taking place in the Pennsylvania city of Philadelphia, following a group of not so great people - Dennis and Dee, siblings, their friends, Mac and Charlie, and their “father,” Frank. </p><p>I feel like I don’t need to convince you to watch this show. You already know how great <em>It’s Always Sunny in Philadelphia </em>is. It’s literally the <a href="https://www.cinemablend.com/television/2560002/its-always-sunny-is-about-to-make-tv-history"><u>longest running (live-action) comedy show</u></a> ever for a reason, because it has such a large fanbase and continuously adapts to some of the darkest humor. This gang has truly <a href="https://www.cinemablend.com/television/2486233/its-always-sunny-in-philadelphia-the-10-worst-things-the-gang-has-ever-done"><u>done some horrible things</u></a> - and honestly, we’re just here for the fun ride and the dark comedic laughs. </p><p><a href="https://www.hulu.com/series/its-always-sunny-in-philadelphia-2171423f-3326-4dfa-b193-b40494e60109"><u><strong>Stream It’s Always Sunny in Philadelphia on Hulu.</strong></u></a></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="sQruijqRF2cqP7XRHFJNaH" name="Kevin Can F Himself.jpg" alt="Annie Murphy on Kevin Can F**K Himself" src="https://cdn.mos.cms.futurecdn.net/sQruijqRF2cqP7XRHFJNaH.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: AMC)</span></figcaption></figure><h2 id="kevin-can-f-himself-amc">Kevin Can F*** Himself (AMC+)</h2><p>One of the newer shows on this list, <a href="https://www.cinemablend.com/television/2569300/kevin-can-fk-himself-streaming-how-to-watch-the-new-show-with-schitts-creek-star-annie-murphy"><u><em>Kevin Can F*** Himself </em></u><u>is a dark comedy</u></a> about Allison, a seemingly normal woman who is trying to find her place in the world while living with the titular Kevin, a man who barely knows how to take care of himself and is sucking the literal life out of her. </p><p>What makes this dark comedy so amazing is that <em>Kevin Can F*** Himself </em>is almost like a hybrid show. On the moments where it wants to show the amazing perspectives of her life, we are taken to a typical sitcom where there is canned laughter and several cameras, but when we dive deep down into the seriousness of her life, it feels more like a drama mixed in with dark comedy. It’s such an enigma of a show and one that any television buff can enjoy. Annie Murphy is also stellar in it. </p><p><a href="https://www.amazon.com/gp/video/detail/amzn1.dv.gti.3e7096ba-a5b2-4f1c-a0f1-ca00bc69e243?autoplay=1&ref_=atv_cf_strg_wb"><u><strong>Stream Kevin Can F*** Himself on AMC+ through Amazon Prime.</strong></u></a></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="AgAMVAiqCt5MRoEsLWuce6" name="3819764744f630decbc8fef5ea527a5821e522d827f79c5289ade3be92ab54fa (1).jpg" alt="Bill Hader in Barry." src="https://cdn.mos.cms.futurecdn.net/AgAMVAiqCt5MRoEsLWuce6.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: HBO)</span></figcaption></figure><h2 id="barry-hbo-max">Barry (HBO Max)</h2><p>HBO knocked it out of the park with this one. <em>Barry </em>is all about the titular character, Barry, a discharged Marine who decides to take the next step in his life by becoming a paid-for-hire hitman. However, when one of his jobs sends him to Los Angeles, he ends up with more drama than he ever could have thought through the theater geeks of the city. </p><p><em>Barry</em> is an amazing dark comedy. Not only is <a href="https://www.cinemablend.com/streaming-news/the-best-bill-hader-movies-and-tv-shows-and-where-to-watch-them"><u>Bill Hader, the star of the show</u></a>, fantastic in his line delivery and comedic timing (I mean, obviously, as an SNL alumnus), his moments of pure drama clash perfectly with his expert jokes. I mean, I never would have thought I’d enjoy a comedy about a hitman “finding himself” in L.A. of all people, but <em>Barry </em>pulls it off so well. </p><p><a href="https://www.hbomax.com/series/urn:hbo:series:GWmKDEwGrA8JInwEAAAL6"><u><strong>Stream Barry on HBO Max. </strong></u></a></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="wWYZmVt2NBGBw9Yafomxtd" name="bojack-horseman-season-5-1569610502396.png" alt="BoJack in BoJack Horseman" src="https://cdn.mos.cms.futurecdn.net/wWYZmVt2NBGBw9Yafomxtd.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="bojack-horseman-netflix-2">BoJack Horseman (Netflix)</h2><p>The first animated show on this list, <em>BoJack Horseman </em>is an <a href="https://www.cinemablend.com/streaming-news/the-best-animated-shows-on-netflix-right-now-for-adults"><u>adult animated series on Netflix</u></a> that tells the story of the titular character, BoJack. He’s a washed-up celebrity who is trying to see if he can make a comeback in life, so he decides to write a tell-all biography with the help of a ghostwriter, in order for his relevance to come back. </p><p>Don’t let the word “animation” turn you off. This show is just as expertly done in its dark comedy as any of the others on this list. <em>BoJack Horseman </em>is the perfect balance of edgy, dark jokes and really raw moments that make you think. Not only will this show make you laugh, but it deals with heavy issues such as depression, anxiety, mental disorders, grief, and so much more. </p><p><a href="https://www.netflix.com/title/70300800"><u><strong>Stream BoJack Horseman on Netflix.</strong></u></a></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="MFbxEavWcfashxcTeZLh7X" name="https___cdn.cnn.com_cnnnext_dam_assets_220112152651-01-after-life-season-3 (1).jpg" alt="Ricky Gervais in After Life." src="https://cdn.mos.cms.futurecdn.net/MFbxEavWcfashxcTeZLh7X.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="after-life-netflix">After Life (Netflix)</h2><p>Starring comedy legend Ricky Gervais, <em>After Life </em>is a dark comedy that tells the tale of a husband who loses his wife tragically. So, he decides to give the middle finger to the rest of the world as depression settles in, and he starts to turn everyone away by being a jerk - but of course, this is turned around on him as well. </p><p><em>After Life </em>is probably one of the lesser known shows on this list just because it’s not really promoted as much, but it’s certainly still worth the time to watch. Ricky Gervais is wonderful in his leading role, and it’s so strange to see him act as a man that’s so bitter about the rest of the world when everyone tries to help him. It’s also a great exploration into what happens to <em>our </em>after life after someone we love passes away, and how we can learn to live through grief. Season 3 just came out, so be sure to watch it now. </p><p><a href="https://www.netflix.com/title/80998491"><u><strong>Stream After Life on Netflix.</strong></u></a></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="w6jD6AJcz9fvvKtUF4jPsN" name="fargo1x01 (1).jpg" alt="Two of the main characters of Season 1 of Fargo." src="https://cdn.mos.cms.futurecdn.net/w6jD6AJcz9fvvKtUF4jPsN.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: FX)</span></figcaption></figure><h2 id="fargo-hulu">Fargo (Hulu)</h2><p>Inspired by the <a href="https://www.cinemablend.com/news/2562361/fargo-behind-the-scenes-facts-about-the-coen-brothers-movie"><u>1996 film of the same name</u></a>, <em>Fargo </em>is an anthology series mixed in with black comedy that takes place in several different states in America, with completely new stories, characters, and a mystery that will captivate you from beginning to end. </p><p>What I love about <em>Fargo </em>is that while it does have a lot of hysterical moments that make me laugh, it also focuses a lot on the mystery that surrounds these areas. But it doesn’t focus too much where the show starts to feel too dramatic. It’s like the perfect balance of both genres and it shows through how many awards this show has gotten. While Season 5 hasn’t been ordered yet, hopefully we’ll get another season soon. And if you haven’t watched it, binge it now.</p><p><a href="https://www.hulu.com/series/203cda1b-7919-40fb-ab36-1e45b3ed2a50"><u><strong>Stream Fargo on Hulu.</strong></u></a></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="kKbbza9hUq6HDS8xuXZmBW" name="rick-and-morty-wonder-land.png" alt="Rick and Morty in their show." src="https://cdn.mos.cms.futurecdn.net/kKbbza9hUq6HDS8xuXZmBW.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Adult Swim)</span></figcaption></figure><h2 id="rick-and-morty-hbo-max">Rick And Morty (HBO Max)</h2><p>Probably one of the most known animated shows <em>ever </em>at this point, <em>Rick and Morty </em>is <a href="https://www.cinemablend.com/television/2492644/the-best-sci-fi-tv-shows-available-to-stream-now">a sci-fi series</a> mixed in with black comedy that follows the titular characters, Rick and Morty, a grandfather-grandson partnership that travels the galaxies through strange portals, weird worlds, and so much more. </p><p><em>Rick and Morty </em>is exactly what I think of when I think dark comedy. This show was <em>made </em>for adults, or at the very youngest, teenagers. It’s jokes are expertly timed and voiced to perfection, mixing in older references that older fans will enjoy and newer references to people who are just getting into the show. What makes this series so great however is that it still somehow <a href="https://www.cinemablend.com/television/2571742/rick-and-morty-major-reveal-rick-and-beth-was-it-real"><u>keeps a crazy storyline</u></a> as the show goes on. </p><p>As zany and ridiculous as it gets, <em>Rick and Morty </em>has a deep, personal story that has its dark moments of intensity - just look at one of its <a href="https://www.cinemablend.com/television/2568779/rick-and-morty-why-rick-sanchez-is-one-of-the-best-characters-on-tv"><u>lead characters, Rick Sanchez</u></a>. Such a compelling and complex character mixed in with brilliant dark comedy. Truly, if dark comedy is your thing, watch this one. </p><p><a href="https://www.hbomax.com/series/urn:hbo:series:GXkRjxwjR68PDwwEAABKJ"><u><strong>Stream Rick and Morty on HBO Max.</strong></u></a></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="xikfhNt565VymSgQKVHae7" name="image (33) (1).jpg" alt="The two main character of The End of the F***ing World." src="https://cdn.mos.cms.futurecdn.net/xikfhNt565VymSgQKVHae7.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="the-end-of-the-f-ing-world-netflix">The End Of The F***ing World (Netflix)</h2><p>This show is truly f***ing hilarious. <em>The End of the F***ing World </em>is a dark comedy about two teens, both with their own issues - one that thinks he’s a psychopath and the other that just has a crap life. They use this to their advantage to head out on a crazy adventure together. </p><p>I have to admit, I feel like <em>The End of the F***ing World </em>is for a specific kind of audience. While it does have dark humor, its delivery is unlike any other show and its two lead actors are some of the best younger actors I’ve seen, creating a dark comedy experience unlike any other. There’s so much that happens in this show I don’t want to give much away, but trust me, you should watch it. It’s seriously good. </p><p><a href="https://www.netflix.com/title/80175722"><u><strong>Stream The End of the F***ing World on Netflix.</strong></u></a></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="cr9Pwb2EjzNUVQ4KpYH3nb" name="KALEY CUOCO FLIGHT ATTENDANT2.png" alt="kaley cuoco the flight attendant season 1 hbo max screenshot" src="https://cdn.mos.cms.futurecdn.net/cr9Pwb2EjzNUVQ4KpYH3nb.png" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: HBO Max)</span></figcaption></figure><h2 id="the-flight-attendant-hbo-max">The Flight Attendant (HBO Max)</h2><p>This <a href="https://www.cinemablend.com/television/2572192/the-best-hbo-max-original-shows-to-stream-so-far"><u>HBO Max original</u></a> is so much fun. <em>The Flight Attendant </em>is about a young woman, who works as a flight attendant (hence the title). Her life is a bit of a mess, mixed in with partying, drugs, alcohol and more. But one morning, she wakes up next to a dead body and has no idea how this happened - or who did it - and she takes it upon herself to figure it out, step by step. </p><p>While <em>The Flight Attendant </em>teeters more on just regular comedy-drama than pure dark comedy, I do think that the premise of the show puts it in that category. I mean, if you woke up to a dead body, the heck would you do? Scream? Yeah, me too, but this woman basically becomes a whole-ass detective and tries to figure out exactly what happened through hilarious means, and I can appreciate her for that. The show is also a great showcase of <a href="https://www.cinemablend.com/streaming-news/kaley-cuoco-what-to-watch-if-you-like-the-big-bang-theory-actress"><u>Kaley Cuoco’s acting talent</u></a> and she deserves all the awards, everywhere. </p><p><a href="https://www.hbomax.com/series/urn:hbo:series:GX5MHsQzwwIuLwgEAAACp"><u><strong>Stream The Flight Attendant on HBO Max.</strong></u></a></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.33%;"><img id="g9WkJYbddspahJ7DPEMSqT" name="Homelander.jpg" alt="Homelander smiles on The Boys" src="https://cdn.mos.cms.futurecdn.net/g9WkJYbddspahJ7DPEMSqT.jpg" mos="" align="middle" fullscreen="" width="1280" height="721" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Prime Video)</span></figcaption></figure><h2 id="the-boys-amazon-prime">The Boys (Amazon Prime)</h2><p>Last, but certainly not least, we have the <a href="https://www.cinemablend.com/television/2486857/the-10-best-superhero-tv-shows-of-the-decade-ranked"><u>superhero series</u></a>, <em>The Boys. </em>This <a href="https://www.cinemablend.com/television/2570421/the-best-amazon-prime-original-shows-to-binge-watch-now"><u>Amazon original series</u></a> takes place in a world where superheroes aren’t just superheroes - they’re marketing tools, press releases, toys, movie stars, and everything else. But these superheroes have dark secrets behind those masks. And one by one, they’ll all get revealed. </p><p>In a world that is <em>filled </em>to the brim with superheroes through the MCU or the DCEU, <em>The Boys </em>is a refreshing take on the genre. Not only are its dark moments <em>very </em>dark (I mean, that opening scene had me laughing and crying - if you know, you know), the show is just bloody entertaining - literally. This series, which doesn&apos;t shy away from violence, is not for the faint of heart. <em>The Boys </em>cast is full of talent, and the story perfectly captures the reality of being a superhero. Such a great one that you should watch, for sure. Now, if <a href="https://www.cinemablend.com/television/2563042/the-boys-season-3-everything-we-know-so-far-about-the-amazon-series"><u>Season 3 of </u><u><em>The Boys</em></u></a> could just come out. I have to check my <a href="https://www.cinemablend.com/television/2022-tv-premiere-dates"><u>2022 TV schedule</u></a> to make room for it on my calendar. </p><p><a href="https://www.amazon.com/The-Boys-Season-1/dp/B0875L45GK"><u><strong>Stream The Boys on Amazon Prime.</strong></u></a></p><p>Truly, these are some of the best shows you can watch right now out there, and when you do, you won’t regret it. You just might have a new favorite show. Now, if you don’t mind me, I’ll be patiently waiting for <em>The Boys </em>Season 3. </p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ Alison Brie's 10 Best Performances In Movies And TV, Ranked  ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/movies/alison-bries-best-performances-in-movies-and-tv-ranked</link>
                                                                            <description>
                            <![CDATA[ Alison Brie has had some awesome roles - here are her best, ranked. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">RMTDBLrVWx8oq7rxDuGxsY</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/upSaLJ82kBpucpGWRLLGaW-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Tue, 05 Oct 2021 22:04:07 +0000</pubDate>                                                                                                                                                                                                                                <category><![CDATA[Movies]]></category>
                                                                                                                    <dc:creator><![CDATA[ Alexandra Ramos ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/4vCq2c3J9ZiZUXQ3hPz69T.png ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Alexandra Ramos is a Content Producer at CinemaBlend. She first started off working in December 2020 as a Freelance Writer after graduating from the Pennsylvania State University with a degree in Journalism and a minor in English. She later moved over to full-time in July of 2021, and primarily works in features for movies, TV, and sometimes video games. She is also the main person who runs both our daily newsletter, The CinemaBlend Daily, and our ReelBlend newsletter that is sent out bi-weekly to patrons.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;
&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What She&#039;s Into&lt;/strong&gt;: Alex is into many things. She loves all kinds of movies except for super sappy romantic ones - with the only redeeming case being The Notebook, and is a big fantasy nerd. She’s a huge fan of the streaming shows that have been released, and loves to watch series’ like The Witcher, Shadow &amp;amp; Bone, and more. Her all-time favorite TV show has to be a solid three-way tie between Breaking Bad, Game of Thrones and Attack on Titan - she just can’t seem to pick one. Alex is also a big Marvel nerd, and will defend Scarlet Witch until her dying day. For years, she’s been an avid gamer, primarily for the PlayStation, and has become a part of the fanbase for games like The Last Of Us, God of War, Spider-Man, and more, but that won’t stop her from playing simple games like Animal Crossing, or FPS’ like Call of Duty. Alex is also a big sports fan and considers herself a couchside coach because she will threaten to throw stuff at her TV if Penn State or the NY Giants are losing (which is often), usually with pizza in her hands.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What She&#039;s Excited About Right Now&lt;/strong&gt;: The Boys Season 4 and its spinoff, Gen V. Invincible Season 2 around the corner. And if the last part of Attack on Titan ever drops, that would be a dream.&lt;/p&gt; ]]></dc:description>
                                                                                                                                <cf:isSponsored>false</cf:isSponsored>
                <cf:hasAffiliateLinks>false</cf:hasAffiliateLinks>
                <cf:isPaid>false</cf:isPaid>
                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/upSaLJ82kBpucpGWRLLGaW-1280-80.jpg">
                                                            <media:credit><![CDATA[NBC]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[Alison Brie as Annie Edison in Community.]]></media:description>                                                            <media:text><![CDATA[Alison Brie as Annie Edison in Community.]]></media:text>
                                <media:title type="plain"><![CDATA[Alison Brie as Annie Edison in Community.]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/upSaLJ82kBpucpGWRLLGaW-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>Alison Brie is, hands down, one of my favorite actresses who has blown up in the last decade. Not only is she extremely talented in both dramatic and comedic roles, her voice-acting skills are excellent as well. From her time on <em>Community </em>to the Netflix series,<em> GLOW, </em>Brie has shown that she’s here to stay in Hollywood. </p><p>But, what are some of her best performances? Which one is the ultimate best? These are the Alison Brie movies and TV shows with her best work, and how you can watch them right now. </p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="hA22fsoTjMrxgMc49egMzQ" name="maxresdefault (14) (1).jpg" alt="Alison Brie in the Five-Year Engagment" src="https://cdn.mos.cms.futurecdn.net/hA22fsoTjMrxgMc49egMzQ.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Universal Pictures)</span></figcaption></figure><h2 id="10-the-five-year-engagement-suzie-barnes-eilhauer">10. The Five-Year Engagement (Suzie Barnes-Eilhauer)</h2><p><em>The Five-Year Engagement, </em>starring Jason Segal and <a href="https://www.cinemablend.com/news/2556155/upcoming-emily-blunt-movies-whats-ahead-for-the-quiet-place-star"><u>Emily Blunt</u></a>, tells the story of a couple whose relationship becomes strained over time, as their engagement steadily gets extended over and over again. </p><p>I’m always a fan of a good romantic comedy, and Alison Brie definitely rocks it as Suzie Eilhauer in <em>The Five-Year Engagement. </em>The only reason I ranked it at number ten is that it just doesn’t stand out at much as the other characters on this list, but it’s still a great performance and a funny movie that anyone would enjoy. Emily Blunt and Jason Segal have great chemistry, as do Alison Brie and Chris Pratt in their supporting roles. </p><p><a href="https://www.hbomax.com/feature/urn:hbo:feature:GX3YZmwvixcLCSgEAAAST"><u><strong>Stream The Five-Year Engagement on HBO Max. </strong></u></a><u><strong><br></strong></u><a href="https://www.amazon.com/gp/video/detail/B008KPDYQY/ref=atv_dp_share_cu_r"><u><strong>Rent The Five-Year Engagement on Amazon.</strong></u></a></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="vGp3GR2ocKFPngDoZwjp8b" name="Alison-Brie-Makenzie-Davis-happies-season (1).jpg" alt="Alison Brie and Mackenzie Davis in Happiest Season." src="https://cdn.mos.cms.futurecdn.net/vGp3GR2ocKFPngDoZwjp8b.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Hulu)</span></figcaption></figure><h2 id="9-happiest-season-sloane-caldwell-xa0">9. Happiest Season (Sloane Caldwell) </h2><p><em>Happiest Season, </em>starring <a href="https://www.cinemablend.com/news/2566845/upcoming-kristen-stewart-movies-TV"><u>Kristen Stewart</u></a> and Mackenzie Davis, is all about a woman who struggles to come out to her conservative parents at Christmastime, when she decides to travel home with her girlfriend.</p><p>Alison Brie plays Sloane, Harper’s (Mackenzie Davis) eldest sister, and she and Davis have some awesome scenes together that really make her stand out among the rest. The rest of the <em>Happiest Season </em>cast also work together so well, and it&apos;s filled with stars like Dan Levy, Aubrey Plaza, Jake McDorman, and more. <a href="https://www.cinemablend.com/news/2560256/the-best-new-movies-to-watch-on-christmas"><u>Christmas films</u></a> are always some of my favorites to watch, and this one is certainly a modern tale that makes me smile. It’s a heartwarming story with plenty of comedy, drama, and Christmas joy in-between. </p><p><a href="https://www.hulu.com/watch/8bd1884d-b39d-4dc7-9c44-29f07de2f1ef"><u><strong>Stream Happiest Season on Hulu.</strong></u></a></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="3LuYkU8RN85hE7ZSmZHha5" name="maxresdefault (15) (1).jpg" alt="Alison Brie voices Princess Unikitty in The Lego Movie." src="https://cdn.mos.cms.futurecdn.net/3LuYkU8RN85hE7ZSmZHha5.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Warner Bros. Pictures)</span></figcaption></figure><h2 id="8-the-lego-movie-princess-unikitty">8. The Lego Movie (Princess Unikitty)</h2><p>In <em>The Lego Movie, </em>we follow Emmet, an ordinary Lego minifigure who ends up joining a resistance movement to stop a tyrannical businessman from taking over Lego world and gluing everything into his vision of perfection. </p><p>Alison Brie voices Princess Unikitty, and let me just say - she’s amazing. Brie gives Princess Unikitty the perfect kind of chaos and cuteness that a character like her needs, and that can only be brought to life by her wonderful voice-acting talents. I do think another one of her voice roles is slightly better than this one, but <em>The Lego Movie </em>definitely gave her some great material to work with, alongside its wacky, yet sweet, story. </p><p><a href="https://www.amazon.com/Lego-Movie-Chris-Pratt/dp/B00IDH9RH4"><u><strong>Rent The Lego Movie on Amazon. </strong></u></a></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="k4D42AYgF7W7mvcQtCToqE" name="439311152 (1).jpg" alt="Alison Brie and Jason Sudeikis in Sleeping with Other People." src="https://cdn.mos.cms.futurecdn.net/k4D42AYgF7W7mvcQtCToqE.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: IFC Films)</span></figcaption></figure><h2 id="7-sleeping-with-other-people-elaine-x201c-lainey-x201d-dalton-xa0">7. Sleeping With Other People (Elaine “Lainey” Dalton) </h2><p>In this 2015 film, <em>Sleeping with Other People </em>is all about two college students who both lose their virginity to each other one night and never see each other again until years later, now having their own personal problems as they deal with relationships and life. </p><p>In one of her first major starring roles in a film, Alison Brie rocks <em>Sleeping with Other People </em>as Lainey, and her chemistry with <a href="https://www.cinemablend.com/news/2574261/jason-sudeikis-movies-and-tv-shows-to-watch-streaming-if-you-like-the-ted-lasso-star"><u>Jason Sudeikis</u></a> flows so perfectly, it makes me wonder why they haven’t been in any other movies together. Their relationship is so easy to believe, from beginning to end, mixed in with some awkwardly fun moments that bring a certain charm to the way they work. It’s a smaller film than many of the others on here, but deserves so much more praise. Seriously, check it out if you haven’t seen it yet. </p><p><a href="https://www.amazon.com/gp/video/detail/B07Y27WMTD/ref=atv_dp_share_cu_r"><u><strong>Stream Sleeping With Other People on AMC+ through Amazon Prime. </strong></u></a><u><strong><br></strong></u><a href="https://www.amazon.com/gp/video/detail/B019HURJZM/ref=atv_dp_share_cu_r"><u><strong>Rent Sleeping With Other People on Amazon.  </strong></u></a></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="pUF869WUqqiT6robRMW5QS" name="glowseason2-1024x522 (1).jpg" alt="Alison Brie in GLOW." src="https://cdn.mos.cms.futurecdn.net/pUF869WUqqiT6robRMW5QS.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="6-glow-ruth-wilder">6. GLOW (Ruth Wilder)</h2><p>In this Netflix original series, <em>GLOW </em>follows the fictionalization of the real people and story of the 1980s during syndicated women’s professional wrestling circuit, called Gorgeous Ladies of Wrestling (otherwise known as GLOW). </p><p><em>GLOW </em>is one of those series that deserved so much more recognition and <a href="https://www.cinemablend.com/television/2564981/netflix-shows-that-were-cancelled-way-too-soon"><u>was cancelled way too soon</u></a>. Alison Brie starred in this Netflix hit, and showed us how remarkable she is as a leading lady. Not only is her character, Ruth, full of spunk and has an interesting story, but everyone else around her shines just as much. It’s a shame that <em>GLOW </em>was canceled on <a href="https://www.cinemablend.com/television/2556179/glow-creators-react-to-netflix-cancellation-despite-season-4-renewal"><u>Netflix due to COVID-19 related issues</u></a>, but at least we still have the three seasons to watch whenever we want on Netflix. Maybe one day they’ll return to it. </p><p><a href="https://www.netflix.com/title/80114988"><u><strong>Stream GLOW on Netflix. </strong></u></a></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="pEnRuEkMjMtuTtbfmDDqHc" name="diane-nguyen (1).jpg" alt="Alison Brie voices Diane in BoJack Horseman." src="https://cdn.mos.cms.futurecdn.net/pEnRuEkMjMtuTtbfmDDqHc.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="5-bojack-horseman-diane-nguyen-xa0">5. BoJack Horseman (Diane Nguyen) </h2><p>Taking a look at another Netflix original, <em>BoJack Horseman </em>is all about the titular character, BoJack Horseman, someone who was once extremely popular back in his heyday, and now barely a blip in the memory of others. He plans to make a comeback by writing his tell-all autobiography, with the help of a ghost writer. </p><p>Alison Brie voices Diane Nguyen, the ghost writer that works for BoJack, and let me say - I <em>love </em>her in this series. While Alison Brie was able to bring that maniac energy to Princess Unikitty in <em>The Lego Movie, </em>Diane stands out to me so much more as her best voice-acting role. Diane’s story in <em>BoJack Horseman </em>is gut-punching and raw and will make anyone tear up for a bit, and her relationship with BoJack is one of the best on the show, by far. She’s a complex character, through and through, and Brie’s voicing of her makes Diane even better. </p><p><a href="https://www.netflix.com/title/70300800"><u><strong>Stream BoJack Horseman on Netflix. </strong></u></a></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="4HqJgD88iZDv23K2PrgmWo" name="6000 (1).jpg" alt="Alison Brie alongside Meryl Streep in The Post." src="https://cdn.mos.cms.futurecdn.net/4HqJgD88iZDv23K2PrgmWo.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: 20th Century Fox)</span></figcaption></figure><h2 id="4-the-post-lally-weymouth">4. The Post (Lally Weymouth)</h2><p>In this film based on a true story, <em>The Post </em>tells the tale of journalists who worked at the Washington Post, and their endless trials to try and publish the infamous Pentagon Papers, a set of documents that regarded the 20-year involvement of the United States government in the Vietnam War, and even earlier in French Indochina. </p><p>While Alison Brie is always brilliant in her comedic roles, there’s something about <em>The Post </em>that really makes it one of her best performances. While her role isn’t as big as some of the other cast members in here - with Meryl Streep and <a href="https://www.cinemablend.com/news/2554371/upcoming-tom-hanks-movies-whats-ahead-for-the-toy-story-star"><u>Tom Hanks</u></a> as the main stars - she is one of the standouts, and portrays Lally Graham, a former journalist at the Washington Post, wonderfully alongside her co-stars.</p><p><a href="https://www.amazon.com/Post-Meryl-Streep/dp/B078XMV6WJ"><u><strong>Rent The Post on Amazon. </strong></u></a></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="do6tEdbJNHPQQ9uszEU6eB" name="041814-alison-brie-mad-men-594 (1).jpg" alt="Alison Brie in Mad Men." src="https://cdn.mos.cms.futurecdn.net/do6tEdbJNHPQQ9uszEU6eB.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: AMC)</span></figcaption></figure><h2 id="3-mad-men-trudy-campbell">3. Mad Men (Trudy Campbell)</h2><p><em>Mad Man </em>was a popular AMC series that starred Jon Hamm as Don Draper, an executive at an advertising agency on Madison Avenue in New York City, hence the term “mad men,” in the 1960s. It follows his highs and lows, and the trials and tribulations of working in the advertising industry back then, and the people who surrounded him. </p><p>Arguably, this is one of the performances that made Alison Brie famous. While she was just a recurring character in the <a href="https://www.cinemablend.com/television/2555414/what-the-mad-men-cast-is-doing-now"><u><em>Mad Men </em></u><u>cast</u></a><em>,</em> her part as the wife of Pete Campbell stands out, creating excellent tension between the two of them and a story that no one can tear their eyes away from. She truly shines in this dramatic role.</p><p><a href="https://www.amazon.com/gp/video/detail/B001A5HBAG/ref=atv_dp_share_cu_r"><u><strong>Stream Mad Men on AMC+ through Amazon Prime. </strong></u></a></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="gSFgGtjJQqxMJdd9WiguQN" name="10264523 (1).jpg" alt="Alison Brie in Promising Young Woman." src="https://cdn.mos.cms.futurecdn.net/gSFgGtjJQqxMJdd9WiguQN.jpg" mos="" align="middle" fullscreen="" width="1280" height="720" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: Focus Features)</span></figcaption></figure><h2 id="2-promising-young-woman-madison-mcphee-xa0">2. Promising Young Woman (Madison McPhee) </h2><p>In this popular thriller, <em>Promising Young Woman </em>stars Carey Mulligan, who plays a young woman who is haunted by a traumatic past, and takes it upon herself to get vengeance on the men who have committed horrible atrocities. </p><p>Alison Brie stars as Madison, one of the many women and men that Mulligan’s character comes across. I’ve already expressed how I like watching Brie in dramatic roles, but I feel like she brings it hard in <em>Promising Young Women. </em>Her role as Madison is perfectly played, especially in her scenes with Cassie, played by Mulligan. Also, the story is top-tier in <em>Promising Young Women. </em>If you <a href="https://www.cinemablend.com/news/2553216/the-best-thrillers-to-stream-on-netflix-right-now"><u>like thrillers,</u></a> you are going to be on the edge of your seat the whole time. It’s such a fun movie to watch, filled with awesome stars, and Alison Brie only adds to that stardom. </p><p><a href="https://www.hbomax.com/feature/urn:hbo:feature:GYPrhpAPc62CutQEAAAAT"><u><strong>Stream Promising Young Woman on HBO Max. </strong></u></a></p><figure class="van-image-figure  inline-layout" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' style="max-width:1280px;"><p class="vanilla-image-block" style="padding-top:56.17%;"><img id="4j5r3qPrkEKeYh6xyh7MeX" name="community-11 (1).jpg" alt="Alison Brie as Annie in Community." src="https://cdn.mos.cms.futurecdn.net/4j5r3qPrkEKeYh6xyh7MeX.jpg" mos="" align="middle" fullscreen="" width="1280" height="719" attribution="" endorsement="" class=""></p></div></div><figcaption itemprop="caption description" class=" inline-layout"><span class="credit" itemprop="copyrightHolder">(Image credit: NBC)</span></figcaption></figure><h2 id="1-community-annie-edison-xa0">1. Community (Annie Edison) </h2><p>This Dan Harmon-created comedy, <em>Community, </em>follows Jeff Winger, a former lawyer who faked his degree, and now must go back to community college to try and become an actual lawyer. While he’s there, he meets an interesting friend group, all comprised of extremely different individuals. </p><p>You knew it was coming. We all knew <em>Community </em>would be number one. While <em>Mad Men </em>shined a light on Alison Brie’s acting talents dramatically, <em>Community </em>is what shot her to stardom with how awesome she was with comedy. Her portrayal of Annie Edison, the studious classmate, is one to remember. The whole <a href="https://www.cinemablend.com/television/2565360/what-the-community-cast-is-doing-now-including-donald-glover"><u><em>Community </em></u><u>cast</u></a> is full of stars, but Alison Brie as Annie works perfectly. Her comedic timing, heartwarming stories, and genuine friendships and relationships that she has with each of the characters created a wonderfully sweet character, which is why it’s Alison Brie’s best performance to date - let’s hope we all get to see her <a href="https://www.cinemablend.com/television/2546629/things-the-community-movie-needs-to-do-or-it-shouldnt-be-made"><u>again in a possible </u><u><em>Community </em></u><u>movie.</u></a> </p><p><a href="https://www.netflix.com/title/70155589"><u><strong>Stream Community on Netflix.</strong></u></a></p><p>I’m sure that in the next couple of years, we’ll be seeing plenty more of Alison Brie in both film and TV, but for now, I can at least go back and watch some of her best performances, from beginning to end. Maybe even now you’ll have found a new show or movie to watch. If you don’t mind me, I’m going to re-watch <em>Community</em> for the umpteenth time. </p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ The Best Comedy TV Shows To Stream On Netflix Right Now ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/2573585/the-best-comedy-tv-shows-to-stream-on-netflix-right-now</link>
                                                                            <description>
                            <![CDATA[ If you're looking for a show that will make you laugh, check out some of the best comedy shows on Netflix. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">22vYEZL6zsBzRSst7kK4kg</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/TDPg6xJKCPHxV6Uhgo34rE-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Sun, 19 Sep 2021 22:04:00 +0000</pubDate>                                                                                                                                                                                                                                <category><![CDATA[Streaming News]]></category>
                                                                                                                    <dc:creator><![CDATA[ Alexandra Ramos ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/4vCq2c3J9ZiZUXQ3hPz69T.png ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Alexandra Ramos is a Content Producer at CinemaBlend. She first started off working in December 2020 as a Freelance Writer after graduating from the Pennsylvania State University with a degree in Journalism and a minor in English. She later moved over to full-time in July of 2021, and primarily works in features for movies, TV, and sometimes video games. She is also the main person who runs both our daily newsletter, The CinemaBlend Daily, and our ReelBlend newsletter that is sent out bi-weekly to patrons.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;
&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What She&#039;s Into&lt;/strong&gt;: Alex is into many things. She loves all kinds of movies except for super sappy romantic ones - with the only redeeming case being The Notebook, and is a big fantasy nerd. She’s a huge fan of the streaming shows that have been released, and loves to watch series’ like The Witcher, Shadow &amp;amp; Bone, and more. Her all-time favorite TV show has to be a solid three-way tie between Breaking Bad, Game of Thrones and Attack on Titan - she just can’t seem to pick one. Alex is also a big Marvel nerd, and will defend Scarlet Witch until her dying day. For years, she’s been an avid gamer, primarily for the PlayStation, and has become a part of the fanbase for games like The Last Of Us, God of War, Spider-Man, and more, but that won’t stop her from playing simple games like Animal Crossing, or FPS’ like Call of Duty. Alex is also a big sports fan and considers herself a couchside coach because she will threaten to throw stuff at her TV if Penn State or the NY Giants are losing (which is often), usually with pizza in her hands.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What She&#039;s Excited About Right Now&lt;/strong&gt;: The Boys Season 4 and its spinoff, Gen V. Invincible Season 2 around the corner. And if the last part of Attack on Titan ever drops, that would be a dream.&lt;/p&gt; ]]></dc:description>
                                                                                                                                <cf:isSponsored>false</cf:isSponsored>
                <cf:hasAffiliateLinks>false</cf:hasAffiliateLinks>
                <cf:isPaid>false</cf:isPaid>
                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/TDPg6xJKCPHxV6Uhgo34rE-1280-80.jpg">
                                                            <media:credit><![CDATA[null]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[The main cast of _Community._]]></media:description>                                                            <media:text><![CDATA[The main cast of _Community._]]></media:text>
                                <media:title type="plain"><![CDATA[The main cast of _Community._]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/TDPg6xJKCPHxV6Uhgo34rE-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="RSfs8T6tYrwfCiMfgZ7kej" name="" alt="BoJack in BoJack Horseman." src="https://cdn.mos.cms.futurecdn.net/RSfs8T6tYrwfCiMfgZ7kej.jpg" mos="https://cdn.mos.cms.futurecdn.net/RSfs8T6tYrwfCiMfgZ7kej.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><p>In this golden age of television, there are plenty of TV dramas that I love to watch, like the <a href="https://www.cinemablend.com/television/2571467/the-best-fantasy-shows-to-stream-right-now" data-original-url="https://www.cinemablend.com/television/2571467/the-best-fantasy-shows-to-stream-right-now">fantasy series</a> <em>Game of Thrones,</em> or even the wonderfully written <em>Breaking Bad.</em> Maybe even catch up on some characters' romantic escapades before <a href="https://www.cinemablend.com/television/2561830/bridgerton-season-2-quick-things-we-know-about-the-netflix-series" data-original-url="https://www.cinemablend.com/television/2561830/bridgerton-season-2-quick-things-we-know-about-the-netflix-series"><em>Bridgerton</em> Season 2</a> comes out. However, while dramas are always intriguing and fun to watch, sometimes I just want to laugh, and comedies do the trick.</p><p>Luckily, there are plenty of comedy TV shows on Netflix for fans to enjoy, from original hits to already popular sitcoms and network hits. If you’re looking for a show that will have you clutching at your side from laughing so much, look no further than right here.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="RoP9yvkD6WHywxRVDHmVwT" name="" alt="Troy and Abed in Community on Netflix." src="https://cdn.mos.cms.futurecdn.net/RoP9yvkD6WHywxRVDHmVwT.png" mos="https://cdn.mos.cms.futurecdn.net/RoP9yvkD6WHywxRVDHmVwT.png" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="community-2009-2015">Community (2009 - 2015)</h2><p><em>Community</em> tells the story of Jeff Winger, who was disbarred and suspended from his law firm after they found out his bachelor’s degree was fake. In order to return, he attends Greendale Community College, where he meets an interesting cast of characters all with their own quirks and odd personalities.</p><p><em>Community</em> is, hands down, one of my favorite shows ever. Created by <em>Rick and Morty</em> creator, Dan Harmon, the jokes always land and will make you laugh regardless of how you’re feeling on any day. And, let’s not even get started with the amazing <a href="https://www.cinemablend.com/television/2565360/what-the-community-cast-is-doing-now-including-donald-glover" data-original-url="https://www.cinemablend.com/television/2565360/what-the-community-cast-is-doing-now-including-donald-glover"><em>Community</em> cast</a>. There are so many stars who blew up once they appeared in this awesome show, such as Donald Glover, <a href="https://www.cinemablend.com/television/2491433/alison-brie-7-things-you-need-to-know-about-the-glow-star" data-original-url="https://www.cinemablend.com/television/2491433/alison-brie-7-things-you-need-to-know-about-the-glow-star">Alison Brie</a>, Ken Jeong - the list goes on and on. Seriously, if you haven’t watched <em>Community</em> yet, give it a shot now. Hopefully that <a href="https://www.cinemablend.com/television/2546629/things-the-community-movie-needs-to-do-or-it-shouldnt-be-made" data-original-url="https://www.cinemablend.com/television/2546629/things-the-community-movie-needs-to-do-or-it-shouldnt-be-made"><em>Community</em> movie</a> comes sooner rather than later.</p><p><a href="https://www.netflix.com/title/70155589"><strong>Stream Community on Netflix.</strong></a></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="yNFL7kQRr8WcutqPnrPvrJ" name="" alt="Tina Fey in 30 Rock." src="https://cdn.mos.cms.futurecdn.net/yNFL7kQRr8WcutqPnrPvrJ.jpg" mos="https://cdn.mos.cms.futurecdn.net/yNFL7kQRr8WcutqPnrPvrJ.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="30-rock-2006-2013">30 Rock (2006 - 2013)</h2><p>Starring Tina Fey, <em>30 Rock</em> revolves around the cast and crew of a fictitious sketch comedy series, which is filmed in Studio 6H at 30 Rockefeller Plaza, focusing on the creation of this show, and the hijinks that come with it.</p><p>Honestly, I think what makes this such a great show is the <a href="https://www.cinemablend.com/television/2571155/30-rock-cast-what-the-nbc-comedy-stars-are-doing-now-including-tina-fey" data-original-url="https://www.cinemablend.com/television/2571155/30-rock-cast-what-the-nbc-comedy-stars-are-doing-now-including-tina-fey"><em>30 Rock</em> cast</a><em>.</em> Not only do they have amazing chemistry with each other, but their characters are really easy to root for and are super funny, from Tina Fey to Alec Baldwin, and Tracy Morgan. Everything works together beautifully. With Tina Fey as one of the main writers of the show, you know it’s going to be funny.</p><p><a href="https://www.netflix.com/title/70136124"><strong>Stream 30 Rock on Netflix.</strong></a></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="AZxy3QwQFMezpST7DhAwAC" name="" alt="The main New Girl cast." src="https://cdn.mos.cms.futurecdn.net/AZxy3QwQFMezpST7DhAwAC.jpg" mos="https://cdn.mos.cms.futurecdn.net/AZxy3QwQFMezpST7DhAwAC.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="new-girl-2011-2018">New Girl (2011 - 2018)</h2><p>In <em>New Girl,</em> Jess is a young woman who just found out her long-term boyfriend has been cheating on her. So, she moves out and into a loft with three strangers, Nick, Winston, and Schmidt, all of whom have their own oddball tendencies that make her new life fun.</p><p><em>New Girl</em> is so wholesome. There are a lot of comedies out there that can sometimes get darker, dipping their toes in drama (like <em>Barry</em> or <em>Orange is the New Black).</em> However, <em>New Girl</em> never does that. It’s really focused on comedy and makes you smile. <a href="https://www.cinemablend.com/television/2571494/new-girl-schmidts-funniest-moments-ranked" data-original-url="https://www.cinemablend.com/television/2571494/new-girl-schmidts-funniest-moments-ranked">Schmidt is the funniest character</a> in my opinion, but everyone else in the <a href="https://www.cinemablend.com/television/2551438/what-the-new-girl-cast-has-been-up-to-since-the-series-finale" data-original-url="https://www.cinemablend.com/television/2551438/what-the-new-girl-cast-has-been-up-to-since-the-series-finale"><em>New Girl</em> cast</a> each has their moment to shine.</p><p><a href="https://www.netflix.com/title/70196145"><strong>Stream New Girl on Netflix.</strong></a></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="o2a9UnEiAVvSwJ5Kw2iUUa" name="" alt="The Rose family on Schitt's Creek." src="https://cdn.mos.cms.futurecdn.net/o2a9UnEiAVvSwJ5Kw2iUUa.jpg" mos="https://cdn.mos.cms.futurecdn.net/o2a9UnEiAVvSwJ5Kw2iUUa.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="schitt-s-creek-2015-2020">Schitt’s Creek (2015 - 2020)</h2><p><em>Schitt’s Creek</em> tells the story of the Rose family, who were once wealthy and then suddenly lose all their assets except for a town, called Schitt’s Creek, they bought decades ago as a joke. Now, while living there, it’s up to them to somehow find a way out and become rich again.</p><p>If you’re looking for a fantastic family comedy, <em>Schitt’s Creek</em> is definitely one of the better ones out there. The entire <a href="https://www.cinemablend.com/television/2557418/what-the-schitts-creek-cast-is-doing-next" data-original-url="https://www.cinemablend.com/television/2557418/what-the-schitts-creek-cast-is-doing-next"><em>Schitt’s Creek</em> cast</a> has such a great dynamic, but my personal favorites are <a href="https://www.cinemablend.com/television/2563579/schitts-creek-the-best-david-and-alexis-moments-from-the-series" data-original-url="https://www.cinemablend.com/television/2563579/schitts-creek-the-best-david-and-alexis-moments-from-the-series">David and Alexis</a>, played by Dan Levy and Annie Murphy. Their sibling rivalry is not only believable, but shows what it’s like to not only fight with your sibling but love them unconditionally, even in the darkest of times. You’ll love them so much you’ll be saying “Ew, David,” not that long after starting the show.</p><p><a href="https://www.netflix.com/title/80036165"><strong>Stream Schitt’s Creek on Netflix.</strong></a></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="Z9t9nosr7LmyDhToQfLbtj" name="" alt="Jacqueline and Kimmy in Unbreakable Kimmy Schmidt." src="https://cdn.mos.cms.futurecdn.net/Z9t9nosr7LmyDhToQfLbtj.jpg" mos="https://cdn.mos.cms.futurecdn.net/Z9t9nosr7LmyDhToQfLbtj.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="unbreakable-kimmy-schmidt-2015-2019-2020">Unbreakable Kimmy Schmidt (2015 - 2019, 2020)</h2><p>In this Netflix original series, <em>Unbreakable Kimmy Schmidt</em> tells the story of Kimmy, a young woman who was kidnapped years ago and locked in a bunker for more than a decade, only to emerge as a fully grown woman in a brand new world, trying to adjust.</p><p>With four seasons, I definitely think <em>Unbreakable Kimmy Schmidt</em> is a great comedy original from Netflix. Ellie Kemper has so much charisma as Kimmy, paired with her out of touch boss, Jacqueline White (played by Jane Krakowski), and her amazingly wonderful roommate Tituss Andromedon (played by Tituss Burgess), it’s a perfectly balanced show. Also, the opening theme to this show is one of the catchiest ones I’ve ever heard - I sing along to it every time. There’s even a special interactive film Netflix did for the show a year after it ended, so give it a chance if you haven’t tuned in yet.</p><p><a href="https://www.netflix.com/title/80025384"><strong>Stream Unbreakable Kimmy Schmidt on Netflix.</strong></a></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="pikcgiQDjK2QgAZ9N637wc" name="" alt="Sheila and Joel in Santa Clarita Diet." src="https://cdn.mos.cms.futurecdn.net/pikcgiQDjK2QgAZ9N637wc.jpg" mos="https://cdn.mos.cms.futurecdn.net/pikcgiQDjK2QgAZ9N637wc.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="santa-clarita-diet-2017-2019-2">Santa Clarita Diet (2017 - 2019)</h2><p>In this original comedy from Netflix, <em>Santa Clarita Diet</em> follows two married real estate agents, but when Sheila suddenly becomes undead and has a craving for human flesh, she and her family must find a way to somehow adapt to their new life.</p><p><em>Santa Clarita Diet</em> is a show on <a href="https://www.cinemablend.com/television/2564981/netflix-shows-that-were-cancelled-way-too-soon" data-original-url="https://www.cinemablend.com/television/2564981/netflix-shows-that-were-cancelled-way-too-soon">Netflix that got cancelled</a> way too soon. It was so funny, and had such a great cast, including the always wonderful Drew Barrymore as the lead. The story itself was also really interesting, including a mythological mystery and plenty of funny, gory moments in a comedy show about someone who looks like a normal person but lives as a zombie. I really wish it went on for longer, but, at least now, you can enjoy all of its glory on Netflix.</p><p><a href="https://www.netflix.com/title/80095815"><strong>Stream Santa Clarita Diet on Netflix.</strong></a></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="ZaiXnbEz9KYsdGpbwakJZR" name="" alt="Some of the main characters on Big Mouth." src="https://cdn.mos.cms.futurecdn.net/ZaiXnbEz9KYsdGpbwakJZR.jpg" mos="https://cdn.mos.cms.futurecdn.net/ZaiXnbEz9KYsdGpbwakJZR.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="big-mouth-2017-present">Big Mouth (2017 - Present)</h2><p><em>Big Mouth</em> centers on teens who are based on creators Nick Kroll and Andrew Goldberg’s upbringing in suburban New York, exploring puberty while embracing a frank way of looking at the human body and sex.</p><p>I’ll be honest - <em>Big Mouth</em> was never my favorite series. I think it’s just because the animation style was never my cup of tea. <em>But</em> that doesn’t mean I can’t acknowledge that it is very funny at times, and also addresses some themes that most comedies don’t ever talk about, including what it’s like to grow up, really digging deep and creating a memorable show that also serves a purpose. Plus, the <em>Big Mouth</em> cast is awesome too, with stars like John Mulaney, Fred Armisen, Maya Rudolph, and more voicing the characters.</p><p><a href="https://www.netflix.com/title/80117038"><strong>Stream Big Mouth on Netflix.</strong></a></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="i97rmTr8QparzXieyWMdVH" name="" alt="Ben Platt in The Politician on Netflix." src="https://cdn.mos.cms.futurecdn.net/i97rmTr8QparzXieyWMdVH.jpg" mos="https://cdn.mos.cms.futurecdn.net/i97rmTr8QparzXieyWMdVH.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="the-politician-2019-2020">The Politician (2019 - 2020)</h2><p>In this Netflix original, <em>The Politician</em> follows Payton Hobart, a wealthy young man from Santa Barbara, and each season revolves around a different political race that his character is involved in, whether that be for school or somewhere else.</p><p>I never thought Netflix would find a way to make politics funny, but <em>The Politician</em> does an amazing job at it. Not only is Ben Platt of <a href="https://www.cinemablend.com/news/2573349/dear-evan-hansen-reviews-critics-ben-platt-kaitlyn-dever" data-original-url="https://www.cinemablend.com/news/2573349/dear-evan-hansen-reviews-critics-ben-platt-kaitlyn-dever"><em>Dear Evan Hansen</em> fame</a> very good as the lead character, but the rest of his co-stars are great as well, including Zoey Deutch, Laura Dreyfuss, Gwyneth Paltrow, and so many others. The story is full of hilarious moments, and with only two seasons to binge, it’s not the longest series but definitely worth the time to watch.</p><p><a href="https://www.netflix.com/title/80241248"><strong>Stream The Politician on Netflix.</strong></a></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="58jUGDXf9jQRY8D7AYJchM" name="" alt="Some of the main characters in The Good Place." src="https://cdn.mos.cms.futurecdn.net/58jUGDXf9jQRY8D7AYJchM.jpg" mos="https://cdn.mos.cms.futurecdn.net/58jUGDXf9jQRY8D7AYJchM.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="the-good-place-2016-2020">The Good Place (2016 - 2020)</h2><p>In this popular series, <em>The Good Place</em> follows Eleanor, a woman who has passed on and has arrived in The Good Place, where those who have been good during their lives go once they die. However, Eleanor realizes something's wrong, because she is not supposed to be there.</p><p>This is another example of a wholesome comedy that I feel anyone could enjoy watching. <a href="https://www.cinemablend.com/television/2490795/the-good-place-what-the-cast-members-are-doing-next" data-original-url="https://www.cinemablend.com/television/2490795/the-good-place-what-the-cast-members-are-doing-next"><em>The Good Place</em> cast</a> is definitely one of the best out there, led by the funny <a href="https://www.cinemablend.com/television/2487993/all-of-kristen-bells-best-characters-ranked" data-original-url="https://www.cinemablend.com/television/2487993/all-of-kristen-bells-best-characters-ranked">Kristen Bell</a>, filled with hilarious jokes and funny moments, but it’s not afraid to make you smile and get you all teary-eyed at the same time. Plus, you’ll also find yourself laughing at how often they try to curse in <em>The Good Place.</em> Holy mother forking shirtballs.</p><p><a href="https://www.netflix.com/title/80113701"><strong>Stream The Good Place on Netflix.</strong></a></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="kjqD32Pd3VQhyJcNV8n5d9" name="" alt="Otis and Maeve in Sex Education." src="https://cdn.mos.cms.futurecdn.net/kjqD32Pd3VQhyJcNV8n5d9.jpg" mos="https://cdn.mos.cms.futurecdn.net/kjqD32Pd3VQhyJcNV8n5d9.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="sex-education-2019-present">Sex Education (2019 - Present)</h2><p>In this popular Netflix original, <em>Sex Education</em> follows Otis Milburn, an insecure student when it comes to sex, but who has a mother who's a sex therapist, so he starts a secret program at school to give other kids advice on sex and relationships.</p><p>This dramedy is definitely another one of those big shows with a huge ensemble, but the <em>Sex Education</em> cast is full of newer and more established stars, all with amazing talent. It is primarily a comedy, but the show isn’t afraid to talk about serious issues, from different sexual identities and their acceptance, to how to properly deal with your first time - it’s the perfect coming-of-age show, and something a lot of people would enjoy.</p><p><a href="https://www.netflix.com/title/80197526"><strong>Stream Sex Education on Netflix.</strong></a></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="vqsNiPwrndzfL7oVQRhH6A" name="" alt="Natasha Lyonne in Russian Doll." src="https://cdn.mos.cms.futurecdn.net/vqsNiPwrndzfL7oVQRhH6A.jpg" mos="https://cdn.mos.cms.futurecdn.net/vqsNiPwrndzfL7oVQRhH6A.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="russian-doll-2019-present">Russian Doll (2019 - Present)</h2><p>Think <em>Groundhog Day,</em> but even funnier. <em>Russian Doll</em> is about a woman named Nadia, who seems caught in an inescapable time loop as the guest of honor at a party one night in New York City. Now, it’s up to her to try and solve the problem.</p><p>First off, Natasha Lyonne is wonderful in her role and rocks it as Nadia. I can’t think of a better person to play the main character. But, <em>Russian Doll</em> is more than just its fun cast, with a funny story that has a lot of twists and turns, and a mystery that’s entertaining from beginning to end. With a <a href="https://www.cinemablend.com/television/2564089/netflixs-russian-doll-season-2-finally-gets-an-update-with-awesome-new-cast-member" data-original-url="https://www.cinemablend.com/television/2564089/netflixs-russian-doll-season-2-finally-gets-an-update-with-awesome-new-cast-member">Season 2 ordered</a> for the popular show, now's the time to binge the first one.</p><p><a href="https://www.netflix.com/title/80211627"><strong>Stream Russian Doll on Netflix.</strong></a></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="tqVXsdmybhYGNCtwPXuuVm" name="" alt="BoJack and Princess Carolyn in BoJack Horesman." src="https://cdn.mos.cms.futurecdn.net/tqVXsdmybhYGNCtwPXuuVm.jpg" mos="https://cdn.mos.cms.futurecdn.net/tqVXsdmybhYGNCtwPXuuVm.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="bojack-horseman-2014-2020-4">BoJack Horseman (2014 - 2020)</h2><p>In this animated comedy, <em>BoJack Horseman</em> follows the titular character, a washed-up star of the 1990s sitcom, Horsin’ Around. Now, he’s trying to plan a comeback by releasing a ghost-written, tell-all autobiography.</p><p><em>BoJack Horseman</em> is definitely one of my favorite adult animated comedies to watch. While there are plenty of stupid funny moments in this wonderfully animated show, <em>BoJack Horseman</em> isn’t afraid to talk about the dark topics of Hollywood, such as drug and alcohol addiction, recklessness, depression, and so much more. It’s definitely a gem of a comedy and deserves all the praise it has gotten over the years.</p><p><a href="https://www.netflix.com/title/70300800"><strong>Stream BoJack Horseman on Netflix.</strong></a></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="2MACfyhefnufrBdeAUyGf8" name="" alt="Some of the main characters of Arrested Development." src="https://cdn.mos.cms.futurecdn.net/2MACfyhefnufrBdeAUyGf8.jpg" mos="https://cdn.mos.cms.futurecdn.net/2MACfyhefnufrBdeAUyGf8.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="arrested-development-2003-2006-2013-2019">Arrested Development (2003 - 2006, 2013 - 2019)</h2><p>Last but not least, we take a look at <em>Arrested Development.</em> In this popular series, we follow the Bluths, a family that was formerly wealthy and very dysfunctional, trying to live their lives now that they have lost their riches.</p><p><em>Arrested Development</em> walked so that <em>Schitt’s Creek</em> could run. This series is honestly one of the funniest shows ever, with a cast that truly stands above the rest, including <a href="https://www.cinemablend.com/news/2493233/the-10-best-jason-bateman-movies-ranked" data-original-url="https://www.cinemablend.com/news/2493233/the-10-best-jason-bateman-movies-ranked">Jason Bateman</a>, Michael Cera, Jeffrey Tambor, and so many others. The series was so popular that it was renewed by Netflix years after it was cancelled by Fox, with the same cast, so you know that it’s definitely entertaining. If dysfunctional families are your favorite, there are none quite like the Bluths.</p><p><a href="https://www.netflix.com/title/70140358"><strong>Stream Arrested Development on Netflix.</strong></a></p><p>These are some of the <a href="https://www.cinemablend.com/television/2564797/the-best-shows-to-binge-watch-on-netflix-right-now" data-original-url="https://www.cinemablend.com/television/2564797/the-best-shows-to-binge-watch-on-netflix-right-now">best shows to binge on Netflix</a>, and now, you have some awesome options if you’re craving comedy and need a good laugh. Now, if you don’t mind me, I’m going to watch <em>Community</em> for the umpteenth time.</p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ Bob's Burgers: What To Watch If You Like The Animated Comedy ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/2567322/bobs-burgers-what-to-watch-if-you-like-the-animated-comedy</link>
                                                                            <description>
                            <![CDATA[ With how popular Bob's Burgers is, here are some of the best shows for you to watch if you're a fan of the adult animated series. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">8XpbXyRXoythndzAJnupgY</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/VfPr7vjnWKzBKMCsPvGAmN-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Sun, 16 May 2021 18:04:00 +0000</pubDate>                                                                                                                                                                                                                                <category><![CDATA[Television]]></category>
                                                                                                                    <dc:creator><![CDATA[ Alexandra Ramos ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/4vCq2c3J9ZiZUXQ3hPz69T.png ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Alexandra Ramos is a Content Producer at CinemaBlend. She first started off working in December 2020 as a Freelance Writer after graduating from the Pennsylvania State University with a degree in Journalism and a minor in English. She later moved over to full-time in July of 2021, and primarily works in features for movies, TV, and sometimes video games. She is also the main person who runs both our daily newsletter, The CinemaBlend Daily, and our ReelBlend newsletter that is sent out bi-weekly to patrons.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;
&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What She&#039;s Into&lt;/strong&gt;: Alex is into many things. She loves all kinds of movies except for super sappy romantic ones - with the only redeeming case being The Notebook, and is a big fantasy nerd. She’s a huge fan of the streaming shows that have been released, and loves to watch series’ like The Witcher, Shadow &amp;amp; Bone, and more. Her all-time favorite TV show has to be a solid three-way tie between Breaking Bad, Game of Thrones and Attack on Titan - she just can’t seem to pick one. Alex is also a big Marvel nerd, and will defend Scarlet Witch until her dying day. For years, she’s been an avid gamer, primarily for the PlayStation, and has become a part of the fanbase for games like The Last Of Us, God of War, Spider-Man, and more, but that won’t stop her from playing simple games like Animal Crossing, or FPS’ like Call of Duty. Alex is also a big sports fan and considers herself a couchside coach because she will threaten to throw stuff at her TV if Penn State or the NY Giants are losing (which is often), usually with pizza in her hands.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What She&#039;s Excited About Right Now&lt;/strong&gt;: The Boys Season 4 and its spinoff, Gen V Season 2, House of the Dragon Season 2, The Bear Season 4, Fallout, and Bridgerton Season 3 because I&#039;m missing my steamy romance.&amp;nbsp;&lt;/p&gt; ]]></dc:description>
                                                                                                                                <cf:isSponsored>false</cf:isSponsored>
                <cf:hasAffiliateLinks>false</cf:hasAffiliateLinks>
                <cf:isPaid>false</cf:isPaid>
                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/VfPr7vjnWKzBKMCsPvGAmN-1280-80.jpg">
                                                            <media:credit><![CDATA[null]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[The Belcher family in _Bob&#039;s Burgers._]]></media:description>                                                            <media:text><![CDATA[The Belcher family in _Bob&#039;s Burgers._]]></media:text>
                                <media:title type="plain"><![CDATA[The Belcher family in _Bob&#039;s Burgers._]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/VfPr7vjnWKzBKMCsPvGAmN-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="L7bSQuau4XgN69E2M3nkDV" name="" alt="Linda Belcher in Bob's Burgers." src="https://cdn.mos.cms.futurecdn.net/L7bSQuau4XgN69E2M3nkDV.jpg" mos="https://cdn.mos.cms.futurecdn.net/L7bSQuau4XgN69E2M3nkDV.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><p><em>CinemaBlend participates in affiliate programs with various companies. We may earn a commission when you click on or make purchases via links.</em></p><p>Adult animation.</p><p>It is a form of TV entertainment that has taken over our screens in the last twenty or so years. From that takeover, we have experienced some of the best of what television has to offer in terms of comedy, wackiness, and fun. One of those shows that took off in this genre was none other than the show about the Belcher family on Bob’s Burgers<em>.</em></p><p>While each of the characters has their own interesting stories and quirky character traits, they still somehow all come together to form something of a beautiful show. However, just because <em>Bob’s Burgers</em> has some awesome episodes and is a great example of what adult animation can be like, that doesn’t mean there aren’t a million other options for fans of the genre to check out. Today, we take a look at shows like <em>Bob’s Burgers,</em> from some <a href="https://www.cinemablend.com/television/2565382/south-park-darkest-moments" data-original-url="https://www.cinemablend.com/television/2565382/south-park-darkest-moments">animated classics like <em>South Park</em></a>, all the way to more recent shows such as <em>BoJack Horseman.</em></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="CG5ABtm3X38NtgMcUQ9V8R" name="" alt="Some of the cast of Central Park." src="https://cdn.mos.cms.futurecdn.net/CG5ABtm3X38NtgMcUQ9V8R.png" mos="https://cdn.mos.cms.futurecdn.net/CG5ABtm3X38NtgMcUQ9V8R.png" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="central-park-apple-tv">Central Park (Apple TV+)</h2><p>I had to put this as the first option on this list because it’s literally created <a href="https://www.cinemablend.com/television/2492581/central-park-why-fans-of-bobs-burgers-should-be-excited-for-new-apple-tv-show" data-original-url="https://www.cinemablend.com/television/2492581/central-park-why-fans-of-bobs-burgers-should-be-excited-for-new-apple-tv-show">by the same people who do <em>Bob’s Burgers</em></a><em>. Central Park,</em> an Apple TV+ musical comedy, revolves around a family living in Central Park who must face off against a greedy land developer who wants to turn Central Park into more apartments and commercial spaces for her own profit.</p><p>I know the premise sounds a bit generic, but trust me when I say there’s nothing quite like <em>Central Park,</em> even if you’ve watched <em>Bob’s Burgers.</em> The musical numbers in this show are off the charts amazing, the characters are fantastic and so funny, and there’s an all-star cast behind it, with the likes of Josh Gad from <em>Frozen,</em> <a href="https://www.cinemablend.com/news/2565497/upcoming-daveed-diggs-movies-and-tv-whats-ahead-for-the-hamilton-star" data-original-url="https://www.cinemablend.com/news/2565497/upcoming-daveed-diggs-movies-and-tv-whats-ahead-for-the-hamilton-star">Daveed Diggs from <em>Hamilton</em></a><em>,</em> Tituss Burgess from <em>Unbreakable Kimmy Schmidt,</em> and so many more. It’s certainly worth a watch.</p><p><a href="https://tv.apple.com/us/show/central-park/umc.cmc.4qe3i11erof30x0vz8nwnjkw3"><strong>Stream Central Park on Apple TV+.</strong></a></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="FAMt7GqRL9bGaPdLmVQAHU" name="" alt="Mordecai and Rigby in Regular Show." src="https://cdn.mos.cms.futurecdn.net/FAMt7GqRL9bGaPdLmVQAHU.jpg" mos="https://cdn.mos.cms.futurecdn.net/FAMt7GqRL9bGaPdLmVQAHU.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="regular-show-hbo-max">Regular Show (HBO Max)</h2><p>While Cartoon Network was known for plenty of amazing cartoons like <em>Courage the Cowardly Dog</em> or <em>The Powerpuff Girls,</em> one show that I felt was highly underrated was <em>Regular Show.</em> This series is all about Rigby, a raccoon, and Mordecai, a blue jay, and their common daily lives as friends while working as groundskeepers at a park, spending most of their days trying to avoid work and have fun instead.</p><p>While this isn’t as raunchy as some of the other shows on this list, <em>Regular Show</em> has humor that can’t quite be beaten, just like <em>Bob’s Burgers.</em> The jokes are some of the funniest out there for a show that was on a children’s channel prior to becoming popular with adult audiences. And some of the storylines are genuinely interesting and so much fun.</p><p><a href="https://play.hbomax.com/page/urn:hbo:page:GXl20QAK1sTC3wwEAAB4I:type:series"><strong>Stream Regular Show on HBO Max.</strong></a></p><p><a href="https://www.amazon.com/Regular-Show-Season-1/dp/B009XSY88K"><strong>Rent Regular Show on Amazon.</strong></a></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="xzrehgv5v9VRVWJRfq7nii" name="" alt="Some of the cast of South Park." src="https://cdn.mos.cms.futurecdn.net/xzrehgv5v9VRVWJRfq7nii.jpg" mos="https://cdn.mos.cms.futurecdn.net/xzrehgv5v9VRVWJRfq7nii.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="south-park-hbo-max">South Park (HBO Max)</h2><p>Oh boy. You want to talk about adult animation, look no further than <em>South Park.</em> This classic Comedy Central television series, which now has 24 seasons, follows the daily lives of third graders (later fourth graders) Kyle, Stan, Eric, and Kenny, and their misadventures in the fictional Colorado town of South Park – where <em>a lot</em> of different people mix and mingle and cause trouble all the time.</p><p>The show has been under controversy for several of its episodes in the past, but that hasn’t stopped <a href="https://hrloga.com/login/1c3bb34e/the-10-best-south-park-episodes-ranked-cinemablend"><em>South Park</em> from becoming a huge hit.</a> For fans of the adult humor in <em>Bob’s Burgers,</em> this is the perfect show for you. Not only is it raunchy and so much fun with its comedy, it really just keeps the same basic format for most of its seasons, so you don’t need to catch up previous episodes. You can start wherever you want. I mean, <a href="https://www.cinemablend.com/television/2548534/what-to-watch-on-streaming-if-you-like-south-park" data-original-url="https://www.cinemablend.com/television/2548534/what-to-watch-on-streaming-if-you-like-south-park">it’s <em>South Park.</em> It's iconic</a>.</p><p><a href="https://play.hbomax.com/page/urn:hbo:page:GXr7SEgRi2sLCAAEAAAQu:type:series"><strong>Stream South Park on HBO Max.</strong></a></p><p><a href="https://www.amazon.com/South-Park-Season-1/dp/B000GDBOPQ"><strong>Rent South Park on Amazon.</strong></a></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="JzAMSvAge6w9aZkLXyKU4M" name="" alt="The main characters of Family Guy in their living room." src="https://cdn.mos.cms.futurecdn.net/JzAMSvAge6w9aZkLXyKU4M.jpg" mos="https://cdn.mos.cms.futurecdn.net/JzAMSvAge6w9aZkLXyKU4M.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="family-guy-hulu">Family Guy (Hulu)</h2><p>Another classic in adult animation. I’m quite sure this was the first show which introduced me to the genre in the first place. <em>Family Guy,</em> <a href="https://www.cinemablend.com/news/2475908/yes-seth-macfarlane-is-still-planning-a-family-guy-movie" data-original-url="https://www.cinemablend.com/news/2475908/yes-seth-macfarlane-is-still-planning-a-family-guy-movie">created by Seth MacFarlane</a>, focuses on the Griffins, otherwise known as Peter, Louis, and their children, Meg, Chris and Stewie, along with their anthropomorphic pet dog, Brian. And oh boy, does this family and the show have their moments of craziness, from zombie apocalypses to pedophiles to everything in between, <em>Family Guy</em> has done it all.</p><p>There are so many moments in <em>Family Guy</em> that truly make you go “huh?” because it’s just such an out-there show. However, that doesn’t change the fact that there are still times in the show that have you laughing your head off. <em>Bob’s Burgers</em> might have a bit more of a wholesome family than the Griffins, but you’ll find yourself connecting with them just as much.</p><p><a href="https://www.hulu.com/series/3c3c0f8b-7366-4d15-88ab-18050285978e"><strong>Stream Family Guy on Hulu.</strong></a></p><p><a href="https://www.amazon.com/Family-Guy-Season-1/dp/B000UUKS7U"><strong>Rent Family Guy on Amazon.</strong></a></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="tqVXsdmybhYGNCtwPXuuVm" name="" alt="Some of the cast of BoJack Horseman." src="https://cdn.mos.cms.futurecdn.net/tqVXsdmybhYGNCtwPXuuVm.jpg" mos="https://cdn.mos.cms.futurecdn.net/tqVXsdmybhYGNCtwPXuuVm.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="bojack-horseman-netflix-3">BoJack Horseman (Netflix)</h2><p>Now, let’s take a look at a Netflix original. Since its premiere, <a href="https://www.cinemablend.com/television/2490436/why-bojack-horseman-season-6-felt-like-a-fitting-ending-to-the-netflix-show" data-original-url="https://www.cinemablend.com/television/2490436/why-bojack-horseman-season-6-felt-like-a-fitting-ending-to-the-netflix-show"><em>BoJack Horseman</em> has been a runaway success</a>. This popular show follows an alternate world, where humans and anthropomorphic animals live side by side, taking place in “Hollywoo” (the D was stolen), and centers on BoJack Horseman, a washed-up star who wants to return to relevance once his autobiography is written.</p><p>Not only is <em>BoJack Horseman</em> a super comedic show, but for fans of <em>Bob’s Burgers,</em> the heartfelt moments will hit you the hardest. Compared to many of the series on this list, <em>BoJack Horseman</em> has some dark moments that really hit you and make you think about life in a certain way, connecting with the viewer on another level, just as there are moments in <em>Bob’s Burgers</em> that get to you. Plus, with a cast list <a href="https://www.cinemablend.com/television/2481223/why-is-netflixs-bojack-horseman-ending-aaron-paul-seems-to-have-a-different-explanation" data-original-url="https://www.cinemablend.com/television/2481223/why-is-netflixs-bojack-horseman-ending-aaron-paul-seems-to-have-a-different-explanation">that includes Aaron Paul</a>, Alison Brie, Will Arnett and so many more, how can you not give it a shot?</p><p><a href="https://www.netflix.com/title/70300800"><strong>Stream BoJack Horseman on Netflix.</strong></a></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="KuyQj5c5Ad9XjZ5HnoRPqP" name="" alt="The cast of The Simpsons in their living room." src="https://cdn.mos.cms.futurecdn.net/KuyQj5c5Ad9XjZ5HnoRPqP.jpg" mos="https://cdn.mos.cms.futurecdn.net/KuyQj5c5Ad9XjZ5HnoRPqP.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="the-simpsons-disney">The Simpsons (Disney+)</h2><p>I feel like I don’t even need to explain what <em>The Simpsons</em> is about, but here I go for those who don’t know. <em>The Simpsons</em> is about the titular family, the Simpsons, and the adventures they have in their daily lives in Springfield, from Bart being a troublemaker, to Homer making mistakes at work, or anything else.</p><p>For <em>Bob’s Burgers</em> fans, this is literally the blueprint for all adult animated TV shows. Did you love the Belcher family? You’ll like the Simpsons family, who have literally been <a href="https://www.cinemablend.com/television/2494338/how-the-simpsons-has-been-affected-by-the-disney-merger-so-far" data-original-url="https://www.cinemablend.com/television/2494338/how-the-simpsons-has-been-affected-by-the-disney-merger-so-far">around since the 1980s</a>. That’s a long time for America’s most popular animated family. I don’t even need to convince you to watch this – you’ve probably already seen an episode or two in your lifetime. And, while the earlier seasons do stand out a bit more, there’s no denying that no one <a href="https://www.cinemablend.com/television/2476664/bobs-burgers-vs-the-simpsons-whos-the-better-animated-family" data-original-url="https://www.cinemablend.com/television/2476664/bobs-burgers-vs-the-simpsons-whos-the-better-animated-family">can quite replace <em>The Simpsons</em></a><em>.</em></p><p><a href="https://www.disneyplus.com/series/the-simpsons/3ZoBZ52QHb4x"><strong>Stream The Simpsons on Disney+.</strong></a></p><p><a href="https://www.amazon.com/The-Simpsons-Season-1/dp/B004GWUR7Y"><strong>Rent The Simpsons on Amazon.</strong></a></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="DZRhcPSEQ6cD85SNGAe37X" name="" alt="The cast of Futurama in one of their many spaceships." src="https://cdn.mos.cms.futurecdn.net/DZRhcPSEQ6cD85SNGAe37X.jpg" mos="https://cdn.mos.cms.futurecdn.net/DZRhcPSEQ6cD85SNGAe37X.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="futurama-hulu">Futurama (Hulu)</h2><p>Fox has produced a lot of great, hit shows, but nothing could quite beat <em>Futurama</em> once it came to Comedy Central<em>.</em> Created by Matt Groening, the same man behind <em>The Simpsons,</em> this popular adult animated show is almost like a workplace sitcom, where we are focused on the employees of Planet Express, an interplanetary delivery company.</p><p>If you want to talk about amazing animation, I always felt that <em>Futurama</em> was ahead of its time with some of the scenes they would produce. The family dynamic of the main group will have anyone who loves <em>Bob’s Burgers</em> smiling. Even though these employees aren’t related by blood, there’s no denying that they all clearly care for each other, no matter what happens. It’s a lot of fun for many reasons.</p><p><a href="https://www.hulu.com/series/futurama-85bf4cc1-cd8b-4469-ad87-7289217a0b74"><strong>Stream Futurama on Hulu.</strong></a></p><p><a href="https://www.amazon.com/Futurama-Season-1/dp/B0015QV4BM"><strong>Rent Futurama on Amazon.</strong></a></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="kYQjFBg2aF2EGmFDC8jVZ8" name="" alt="Rick, Morty and Summer in Rick and Morty." src="https://cdn.mos.cms.futurecdn.net/kYQjFBg2aF2EGmFDC8jVZ8.jpg" mos="https://cdn.mos.cms.futurecdn.net/kYQjFBg2aF2EGmFDC8jVZ8.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="rick-and-morty-hbo-max-2">Rick and Morty (HBO Max)</h2><p><a href="https://www.cinemablend.com/news/2558979/5-reasons-why-a-rick-and-morty-movie-should-happen" data-original-url="https://www.cinemablend.com/news/2558979/5-reasons-why-a-rick-and-morty-movie-should-happen">Oh, <em>Rick and Morty</em></a><em>.</em> I feel like there’s this preconceived notion that you have to be into science to enjoy this show, but you don’t at all. In fact, <em>Rick and Morty</em> is anything but super science-based, and they explain so much to you. This popular show, created by Dan Harmon, centers on the <a href="https://www.cinemablend.com/television/2565933/rick-and-morty-season-5-premiere-date-cast-and-other-quick-things-we-know" data-original-url="https://www.cinemablend.com/television/2565933/rick-and-morty-season-5-premiere-date-cast-and-other-quick-things-we-know">titular Rick and Morty</a>, a brilliant scientist and his grandson, who go on crazy scientific adventures across the galaxy.</p><p>There’s a reason why this show was renewed for so many seasons all at once. Not only is the comedy top-notch, and the animation pretty cool, the side characters are even entertaining with their stories, before everything usually combines near the end to create something perfect. It’s certainly not the same family dynamic as <em>Bob’s Burgers,</em> but the adventures and hijinks that this family gets up to certainly feel familiar. If you’re not <a href="https://www.cinemablend.com/television/2565575/rick-and-morty-streaming-how-to-watch-the-adult-swim-series" data-original-url="https://www.cinemablend.com/television/2565575/rick-and-morty-streaming-how-to-watch-the-adult-swim-series">burping like Rick near the end of your binge-watch</a>, you didn’t binge correctly.</p><p><a href="https://play.hbomax.com/page/urn:hbo:page:GXkRjxwjR68PDwwEAABKJ:type:series"><strong>Stream Rick and Morty on HBO Max.</strong></a></p><p><a href="https://www.amazon.com/Rick-and-Morty-Season-1/dp/B00GPZZOT6"><strong>Rent Rick and Morty on Amazon.</strong></a></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="ZaiXnbEz9KYsdGpbwakJZR" name="" alt="Some of the main characters of Big Mouth." src="https://cdn.mos.cms.futurecdn.net/ZaiXnbEz9KYsdGpbwakJZR.jpg" mos="https://cdn.mos.cms.futurecdn.net/ZaiXnbEz9KYsdGpbwakJZR.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="big-mouth-netflix">Big Mouth (Netflix)</h2><p>Another Netflix original on here – and honestly one of the <a href="https://www.cinemablend.com/television/2564797/the-best-shows-to-binge-watch-on-netflix-right-now" data-original-url="https://www.cinemablend.com/television/2564797/the-best-shows-to-binge-watch-on-netflix-right-now">best shows on Netflix</a>, <em>Big Mouth</em> centers around a group of teens based on the creators, and their upbringing in New York, exploring themes of puberty, the human body, and of course, sex.</p><p>Out of all the other adult animated shows on here, I think <em>Big Mouth</em> gets the closest to raunchiness in relation to <em>South Park.</em> However, fans of <em>Bob’s Burgers</em> will instantly be reminded of the awkwardness of Tina when faced with the characters of <em>Big Mouth,</em> and if anything, will laugh even more because uncomfortable situations regarding teens growing up are explored with a surprising amount of depth, creating a <a href="https://www.cinemablend.com/television/1707839/big-mouth-review-netflixs-coming-of-age-cartoon-is-hilariously-crude-yet-shockingly-earnest" data-original-url="https://www.cinemablend.com/television/1707839/big-mouth-review-netflixs-coming-of-age-cartoon-is-hilariously-crude-yet-shockingly-earnest">healthy and comedic conversation about what it’s like to grow up</a>. Plus, some of the songs in this are killer and iconic in their own right.</p><p><a href="https://www.netflix.com/title/80117038"><strong>Stream Big Mouth on Netflix.</strong></a></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="HFPj8TJNbc723iqW7EhshK" name="" alt="Some of the cast of Archer." src="https://cdn.mos.cms.futurecdn.net/HFPj8TJNbc723iqW7EhshK.jpg" mos="https://cdn.mos.cms.futurecdn.net/HFPj8TJNbc723iqW7EhshK.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="archer-hulu">Archer (Hulu)</h2><p><em>Archer</em> follows the story of eight secret agents, all with their own issues and dysfunctional in their own way, who work for the International Secret Intelligence Service (ISIS), a fictional intelligence agency.</p><p>I know, that already sounds like a riot considering that name for the company, but there is just something about <em>Archer</em> that reminds me of <em>Bob’s Burgers,</em> even though it’s not remotely the same. It’s possibly the comedy that comes from its eight main characters, or it could be the interesting animation choices that are made, or the heartfelt lessons that are learned occasionally – either way, I find myself rewatching <em>Archer</em> often. I think it’s worth a shot if you love <em>Bob’s Burgers.</em></p><p><a href="https://www.hulu.com/series/archer-22b4b3c8-0827-42d2-a841-50e8f3464dc2"><strong>Stream Archer on Hulu.</strong></a></p><p><a href="https://www.amazon.com/ARCHER-SEASON-1/dp/B00337ZGIS"><strong>Rent Archer on Amazon.</strong></a></p><p>With all the <a href="https://www.cinemablend.com/television/2566590/2021-summer-tv-premiere-schedule-list-of-new-and-returning-shows" data-original-url="https://www.cinemablend.com/television/2566590/2021-summer-tv-premiere-schedule-list-of-new-and-returning-shows">2021 Summer TV shows</a> starting to premiere soon, I need to double-check to make sure any of these shows are having new seasons or episodes coming out. I know that, no matter what, I’ll be sitting in front of my TV, waiting anxiously for the next entry to join these awesome adult animated shows.</p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ The Best Original Netflix TV Shows, Including Stranger Things ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/2564435/the-best-original-netflix-tv-shows-including-stranger-things</link>
                                                                            <description>
                            <![CDATA[ Netflix has a ton of great original series like Stranger Things. Here's the cream of the crop. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">2HviM63nQFEVqPkTduenkK</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/ZgkBwWBcQFaDgw938osyZL-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Sat, 20 Mar 2021 15:04:00 +0000</pubDate>                                                                                                                                                                                                                                <category><![CDATA[Streaming News]]></category>
                                                                                                                    <dc:creator><![CDATA[ Philip Sledge ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/EkAcyCb4XhyxmBbguSQhEX.jpg ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Philip Sledge is a content writer at CinemaBlend with a focus on longform features. He started writing for the website in December 2019, though his journey in journalism started years earlier. Writing gigs with school newspapers, multiple daily newspapers, and other varied job experiences led him to this point where he actually gets to write about movies, shows, wrestling, and documentaries (which is a huge win in his eyes).&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What He&#039;s Into&lt;/strong&gt;: As has been in the case for many years, Philip loves all things professional wrestling (especially early &#039;90s WCW and late-stage WCW if we&#039;re being honest). But outside of the squared circle, Philip is obsessed with all things George A. Romero as you can probably tell by the plethora of zombie stories he&#039;s written over the years. Documentaries, especially Frontline specials, are another passion for Philip, and he can often be heard going on and on about why everyone should watch some random doc about an obscure movie no one has ever seen before.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What He&#039;s Excited About Right Now&lt;/strong&gt;: Oppenheimer... so much so that his wife has asked him multiple times to stop talking about it (but he keeps doing it). He&#039;s also into Peacock&#039;s Twisted Metal series, which has rekindled his love of the classic vehicular combat video game. And since we&#039;re being all nostaglic, he&#039;s pumped to see Teenage Mutant Ninja Turtles: Mutant Mayhem.&lt;/p&gt; ]]></dc:description>
                                                                                                                                <cf:isSponsored>false</cf:isSponsored>
                <cf:hasAffiliateLinks>false</cf:hasAffiliateLinks>
                <cf:isPaid>false</cf:isPaid>
                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/ZgkBwWBcQFaDgw938osyZL-1280-80.jpg">
                                                            <media:credit><![CDATA[null]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[The Stranger Things cast netflix season 3]]></media:description>                                                            <media:text><![CDATA[The Stranger Things cast netflix season 3]]></media:text>
                                <media:title type="plain"><![CDATA[The Stranger Things cast netflix season 3]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/ZgkBwWBcQFaDgw938osyZL-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p><em>CinemaBlend participates in affiliate programs with various companies. We may earn a commission when you click on or make purchases via links.</em></p><p>There is no way to get around it, there are an insane number of great <a href="https://www.cinemablend.com/television/2560280/2021-netflix-tv-series-premiere-date-schedule-full-list-shows-streaming" data-original-url="https://www.cinemablend.com/television/2560280/2021-netflix-tv-series-premiere-date-schedule-full-list-shows-streaming">Netflix TV shows,</a> with something for literally everyone (at least everyone who loves critically acclaimed series from a myriad of genres). Keeping track of them all, however, is a task that is easier said than done.</p><p>From entertaining and enchanting sci-fi adventure stories like Stranger Things, to hilarious and disturbing dark comedies like <em>Dead to Me</em>, the library of originals keeps growing by the year, so much so that sometimes we find ourselves forgetting about all the awesome <a href="https://www.cinemablend.com/news/2553720/the-best-movies-on-netflix-right-now" data-original-url="https://www.cinemablend.com/news/2553720/the-best-movies-on-netflix-right-now">movies on Netflix</a>, which, as we should remember, was what brought us all to the streamer way back when. But, before we get too sidetracked, let’s break down the best original Netflix shows. There’s a lot, so buckle up…</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="fMWqV4QKU5gdxdBTrmuPXV" name="" alt="David Harbour on Stranger Things" src="https://cdn.mos.cms.futurecdn.net/fMWqV4QKU5gdxdBTrmuPXV.jpg" mos="https://cdn.mos.cms.futurecdn.net/fMWqV4QKU5gdxdBTrmuPXV.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="stranger-things-2016-present">Stranger Things (2016 - Present)</h2><p>Whether you’re obsessed with all things ‘80s (the culture, the style, Dungeons & Dragons), a longtime horror-hound, or simply someone who loves superbly written television, <em>Stranger Things</em> is right for you. As we look toward the show’s highly anticipated return with <a href="https://www.cinemablend.com/television/2485707/stranger-things-season-4-what-we-know-so-far" data-original-url="https://www.cinemablend.com/television/2485707/stranger-things-season-4-what-we-know-so-far"><em>Stranger Things</em> Season 4</a>, now is the perfect time to go back and see how it all started for Eleven, Hopper (and <a href="https://www.cinemablend.com/television/2560820/david-harbours-latest-stranger-things-tease-will-make-hopper-fans-very-happy" data-original-url="https://www.cinemablend.com/television/2560820/david-harbours-latest-stranger-things-tease-will-make-hopper-fans-very-happy">how he ended up in Russia</a>), and the rest of the residents of Hawkins, Indiana, and all their adventures.</p><p><a href="https://www.netflix.com/title/80057281"><strong>Stream</strong> <em><strong>Stranger Things</strong></em> <strong>on Netflix.</strong></a></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="UeJSXcVFHwT37HLXhf8xQ9" name="" alt="Anya Taylor-Joy in The Queen's Gambit" src="https://cdn.mos.cms.futurecdn.net/UeJSXcVFHwT37HLXhf8xQ9.jpg" mos="https://cdn.mos.cms.futurecdn.net/UeJSXcVFHwT37HLXhf8xQ9.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="the-queen-s-gambit-2020">The Queen’s Gambit (2020)</h2><p>The 2020 limited series The Queen’s Gambit is hands down one of the best shows, not only on Netflix, but anywhere to come out in the past few years. From Beth Harmon’s (Anya Taylor-Joy) days learning to play chess in the basement of an orphanage to becoming the top player in the world by <a href="https://www.cinemablend.com/television/2558601/the-queens-gambit-ending-explained" data-original-url="https://www.cinemablend.com/television/2558601/the-queens-gambit-ending-explained#:~:text=In%20the%20final%20moments%20of,same%20group%20of%20old%20men">the show’s fulfilling ending</a>, there isn’t a dull moment. Hell, you don’t even have to love the game of chess (or know anything about it) to get wrapped up in this binge-worthy drama.</p><p><a href="https://www.netflix.com/title/80234304"><strong>Stream</strong> <em><strong>The Queen’s Gambit</strong></em> <strong>on Netflix.</strong></a></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="DDc6LrTWE4ciVugTwCSvYQ" name="" alt="Olivia Colman on The Crown" src="https://cdn.mos.cms.futurecdn.net/DDc6LrTWE4ciVugTwCSvYQ.jpg" mos="https://cdn.mos.cms.futurecdn.net/DDc6LrTWE4ciVugTwCSvYQ.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="the-crown-2016-present">The Crown (2016 - Present)</h2><p>There is a reason (multiple reasons, actually) why The Crown is one of the best shows on television right now, but for the sake of brevity we’ll only dive into a couple of them here. First, the cast (which has taken home acting awards in each of its four seasons), no matter who’s playing whom, has been amazing from the beginning and only continues to get better with each iteration of the royal family. Then you have Peter Morgan’s attention to detail and dedication to treating his subjects with respect but also not holding back his portrayal of Queen Elizabeth II and the world around her. Add those together with the music and the show’s ability to make the audience care about every single character and you have a recipe for greatness.</p><p><a href="https://www.netflix.com/title/80025678"><strong>Stream</strong> <em><strong>The Crown</strong></em> <strong>on Netflix.</strong></a></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="SN7oFWjSPKa95idMoj5i7e" name="" alt="Regé-Jean Page and Phoebe Dynevor on Bridgerton" src="https://cdn.mos.cms.futurecdn.net/SN7oFWjSPKa95idMoj5i7e.jpg" mos="https://cdn.mos.cms.futurecdn.net/SN7oFWjSPKa95idMoj5i7e.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="bridgerton-2020-present">Bridgerton (2020 - Present)</h2><p>There are <a href="https://www.cinemablend.com/television/2561013/bridgerton-major-questions-we-hope-season-2-will-answer" data-original-url="https://www.cinemablend.com/television/2561013/bridgerton-major-questions-we-hope-season-2-will-answer">still plenty of questions</a> after the whirlwind that was the first season of <em>Bridgerton,</em> but <a href="https://www.cinemablend.com/television/2559844/netflix-and-shonda-rhimes-bridgerton-could-be-the-most-scandalous-period-drama-since-sanditon" data-original-url="https://www.cinemablend.com/television/2559844/netflix-and-shonda-rhimes-bridgerton-could-be-the-most-scandalous-period-drama-since-sanditon">the scandalous Netflix period drama</a>, with its fair share of sex, drama, and sexy drama did breathe new life into the genre upon its release in late 2020. With its outstanding ensemble cast that is as talented as it is diverse, the incorporation of modern songs into England’s Regency era, and all those fanciful costumes, there are plenty of reasons why <em>Bridgerton</em> grabbed a hold of its audience and never let go.</p><p><a href="https://www.netflix.com/title/80232398"><strong>Stream</strong> <em><strong>Bridgerton</strong></em> <strong>on Netflix.</strong></a></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="xTtDqVDKGFAnabcrQtnaUd" name="" alt="Jonathan Groff on Mindhunter" src="https://cdn.mos.cms.futurecdn.net/xTtDqVDKGFAnabcrQtnaUd.jpg" mos="https://cdn.mos.cms.futurecdn.net/xTtDqVDKGFAnabcrQtnaUd.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="mindhunter-2017-2019">Mindhunter (2017 - 2019?)</h2><p>Who knows if we’ll ever <a href="https://www.cinemablend.com/television/2557632/mindhunters-david-fincher-has-bad-news-for-fans-hoping-for-season-3-on-netflix" data-original-url="https://www.cinemablend.com/television/2557632/mindhunters-david-fincher-has-bad-news-for-fans-hoping-for-season-3-on-netflix">get to see <em>Mindhunter</em> Season 3</a>, but let’s not dwell on things like that right now. Instead, let’s look back on the two amazing seasons David Fincher gave us in his drama about the formation of the FBI’s criminal psychology department led by Holden Ford (Jonathan Groff), Bill Tench (Holt McCallany), and Wendy Carr (Anna Torv). From engaging personal dramas involving the central cast to all those great interviews with <a href="https://www.cinemablend.com/television/2487202/netflixs-mindhunter-how-accurate-is-the-shows-depictions-of-various-serial-killers" data-original-url="https://www.cinemablend.com/television/2487202/netflixs-mindhunter-how-accurate-is-the-shows-depictions-of-various-serial-killers">the likes of Ed Kemper</a> (Cameron Britton) to the dramatization of the Atlanta Child Murders, this show has (had?) it all.</p><p><a href="https://www.netflix.com/title/80114855"><strong>Stream</strong> <em><strong>Mindhunter</strong></em> <strong>on Netflix.</strong></a></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="nhP8FEFYHRTesGMr6mv5Va" name="" alt="Laura Linney on Ozark" src="https://cdn.mos.cms.futurecdn.net/nhP8FEFYHRTesGMr6mv5Va.jpg" mos="https://cdn.mos.cms.futurecdn.net/nhP8FEFYHRTesGMr6mv5Va.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="ozark-2017-present">Ozark (2017 - Present)</h2><p>The Netflix family crime drama <em>Ozark</em> is one of the <a href="https://www.cinemablend.com/television/2563109/tv-shows-cancelled-or-ending-in-2021-ncis-new-orleans-last-man-standing" data-original-url="https://www.cinemablend.com/television/2563109/tv-shows-cancelled-or-ending-in-2021-ncis-new-orleans-last-man-standing">TV shows ending in 2021,</a> with its <a href="https://www.cinemablend.com/television/2558676/ozark-season-4-quick-things-we-know-about-the-netflix-show" data-original-url="https://www.cinemablend.com/television/2558676/ozark-season-4-quick-things-we-know-about-the-netflix-show">fourth and final season</a> being split up into two parts. This just means you have a little more time to rewatch the Primetime Emmy Award-winning series or start it for the first time before the final chapter. <a href="https://www.cinemablend.com/television/2557884/where-youve-seen-the-ozark-cast-before" data-original-url="https://www.cinemablend.com/television/2557884/where-youve-seen-the-ozark-cast-before">Anchored by a cast</a> that includes Jason Bateman, Laura Linney, and Julia Garner as people embroiled in criminal enterprises, <em>Ozark</em> is dark, twisted, and no surprise here, a rather enjoyable experience.</p><p><a href="https://www.netflix.com/title/80117552"><strong>Stream</strong> <em><strong>Ozark</strong></em> <strong>on Netflix.</strong></a></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="Xq8KMkKKrNQtpkUr7PUHE9" name="" alt="The Dear White People cast" src="https://cdn.mos.cms.futurecdn.net/Xq8KMkKKrNQtpkUr7PUHE9.jpg" mos="https://cdn.mos.cms.futurecdn.net/Xq8KMkKKrNQtpkUr7PUHE9.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="dear-white-people-2017-present">Dear White People (2017 - Present)</h2><p>Anytime an Ivy League university claims to be “post-racial,” you know it is going to be anything but, and the characters in Dear White People, the long-running <a href="https://www.cinemablend.com/television/2549809/6-excellent-netflix-original-streaming-shows-that-not-enough-people-talk-about" data-original-url="https://www.cinemablend.com/television/2549809/6-excellent-netflix-original-streaming-shows-that-not-enough-people-talk-about">Netflix dramedy</a> know that all too well. Based on the 2014 film of the same name, the show doesn’t hold back in its handling of issues such as race, class, and social justice in this gripping and biting <a href="https://www.cinemablend.com/news/2547580/great-movies-that-explore-race-and-social-justice" data-original-url="https://www.cinemablend.com/news/2547580/great-movies-that-explore-race-and-social-justice">critique of the modern educational system</a>. With enough humor to balance out some of the more dramatic elements, <em>Dear White People</em> will have you on an emotional roller coaster throughout.</p><p><a href="https://www.netflix.com/title/80095698"><strong>Stream</strong> <em><strong>Dear White People</strong></em> <strong>on Netflix.</strong></a></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="eHUa8PyEo38YwDsqonrMj3" name="" alt="Natasha Lyonne on Russian Doll" src="https://cdn.mos.cms.futurecdn.net/eHUa8PyEo38YwDsqonrMj3.jpg" mos="https://cdn.mos.cms.futurecdn.net/eHUa8PyEo38YwDsqonrMj3.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="russian-doll-2019-present-2">Russian Doll (2019 - Present)</h2><p>We’re currently living in the golden age of time loop stories, and the Netflix series Russian Doll is proof of that. The show follows Nadia (Natasha Lyonne, who also co-created the show with Leslye Headland and Amy Poehler), a woman who keeps dying and reliving her 36th birthday party as she attempts to make sense of the madness around her. With clever writing, direction, and performances from its central cast, <em>Russian Doll</em> sinks its teeth into its premise from the first scene and doesn’t let go until the season finale. Don’t worry, <a href="https://www.cinemablend.com/television/2564089/netflixs-russian-doll-season-2-finally-gets-an-update-with-awesome-new-cast-member" data-original-url="https://www.cinemablend.com/television/2564089/netflixs-russian-doll-season-2-finally-gets-an-update-with-awesome-new-cast-member">there’s more on the way</a>.</p><p><a href="https://www.netflix.com/title/80211627"><strong>Stream</strong> <em><strong>Russian Doll</strong></em> <strong>on Netflix.</strong></a></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="j9MM92KLN5CGAMcCfGV4dA" name="" alt="The Umbrella Academy cast" src="https://cdn.mos.cms.futurecdn.net/j9MM92KLN5CGAMcCfGV4dA.jpg" mos="https://cdn.mos.cms.futurecdn.net/j9MM92KLN5CGAMcCfGV4dA.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="the-umbrella-academy-2019-present">The Umbrella Academy (2019 - Present)</h2><p>Fans of quirky superhero adventure stories will surely love The Umbrella Academy, the Netflix original series about a group of estranged siblings with some truly amazing powers who are brought together by their father’s death and end up banding together to save the world. There is already a great deal of <a href="https://www.cinemablend.com/television/2559193/umbrella-academy-showrunner-shared-first-season-3-premiere-detail-so-let-the-speculation-begin" data-original-url="https://www.cinemablend.com/television/2559193/umbrella-academy-showrunner-shared-first-season-3-premiere-detail-so-let-the-speculation-begin">speculation surrounding Season 3</a>, so why not go back and start it again so you’re more than ready when <em>The Umbrella Academy</em> makes its eventual return.</p><p><a href="https://www.netflix.com/title/80186863"><strong>Stream</strong> <em><strong>The Umbrella Academy</strong></em> <strong>on Netflix.</strong></a></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="jcjmBeDiB4LiH7AHiKzBNR" name="" alt="Betty Gilpin and Alison Brie on GLOW" src="https://cdn.mos.cms.futurecdn.net/jcjmBeDiB4LiH7AHiKzBNR.jpg" mos="https://cdn.mos.cms.futurecdn.net/jcjmBeDiB4LiH7AHiKzBNR.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="glow-2017-2019">GLOW (2017 - 2019)</h2><p>One of <a href="https://www.cinemablend.com/television/2559914/survey-reveals-netflix-cancellations-that-fans-are-most-upset-about-but-daredevil-somehow-isnt-on-it" data-original-url="https://www.cinemablend.com/television/2559914/survey-reveals-netflix-cancellations-that-fans-are-most-upset-about-but-daredevil-somehow-isnt-on-it">the Netflix cancellations</a> fans were most upset to see go, <em>GLOW</em> was truly something special. One part history lesson about one of the most notorious promotions in the ‘80s and one part drama about a struggling actress finding a place for herself in the world, <a href="https://www.cinemablend.com/news/2494677/what-to-watch-on-netflix-if-you-love-wrestling" data-original-url="https://www.cinemablend.com/news/2494677/what-to-watch-on-netflix-if-you-love-wrestling">the wrestling-based Netflix comedy</a> was a slobberknocker of a good time. The wrestling, writing, acting, and general feel of the show were all top notch, and it’s a bummer that we’ll <a href="https://www.cinemablend.com/television/2556208/alison-brie-and-more-glow-stars-react-to-netflixs-sudden-cancellation-after-three-seasons" data-original-url="https://www.cinemablend.com/television/2556208/alison-brie-and-more-glow-stars-react-to-netflixs-sudden-cancellation-after-three-seasons">never get a proper conclusion</a> for the glorious ladies of wrestling.</p><p><a href="https://www.netflix.com/title/80114988"><strong>Stream</strong> <em><strong>GLOW</strong></em> <strong>on Netflix.</strong></a></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="jJKFqNV4TeDoo3zEw3VHxP" name="" alt="dead to me cast netflix" src="https://cdn.mos.cms.futurecdn.net/jJKFqNV4TeDoo3zEw3VHxP.jpg" mos="https://cdn.mos.cms.futurecdn.net/jJKFqNV4TeDoo3zEw3VHxP.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="dead-to-me-2019-present">Dead To Me (2019 - Present)</h2><p><a href="https://www.cinemablend.com/television/2558132/dead-to-me-season-3-quick-things-to-know-about-the-last-season" data-original-url="https://www.cinemablend.com/television/2558132/dead-to-me-season-3-quick-things-to-know-about-the-last-season"><em>Dead to Me</em> Season 3</a> will the end of the road for this dark comedy about two California women with one hell of a way of bonding, but at least Liz Feldman’s series starring Christina Applegate and Linda Cardellini will be <a href="https://www.cinemablend.com/television/2549563/netflixs-dead-to-me-renewed-for-season-3-but-its-not-all-good-news" data-original-url="https://www.cinemablend.com/television/2549563/netflixs-dead-to-me-renewed-for-season-3-but-its-not-all-good-news">going out on its own terms</a>. Over the course of the show’s <a href="https://www.cinemablend.com/television/2496029/craziest-twists-in-dead-to-me-season-2" data-original-url="https://www.cinemablend.com/television/2496029/craziest-twists-in-dead-to-me-season-2">first two seasons</a>, we watched as Jen Harding (Applegate) and Judy Hale (Cardellini) met in a grief support group and form a rather unique bond, considering their situations. Cleverly written and brilliantly acted, this refreshing take on the grieving process is shockingly fun to watch.</p><p><a href="https://www.netflix.com/title/80219707"><strong>Stream</strong> <em><strong>Dead To Me</strong></em> <strong>on Netflix.</strong></a></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="QXfEhKXfjY49U5RZtcn9T5" name="" alt="daredevil netflix" src="https://cdn.mos.cms.futurecdn.net/QXfEhKXfjY49U5RZtcn9T5.jpg" mos="https://cdn.mos.cms.futurecdn.net/QXfEhKXfjY49U5RZtcn9T5.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="daredevil-2015-2018">Daredevil (2015 - 2018)</h2><p>Long before Disney+ came around and starting launching a slew of <a href="https://www.cinemablend.com/television/1556579/upcoming-marvel-tv-shows-the-full-list-of-whats-ahead" data-original-url="https://www.cinemablend.com/television/1556579/upcoming-marvel-tv-shows-the-full-list-of-whats-ahead">Marvel TV shows</a>, Netflix produced several series centering on some of the comic book publisher’s more grounded characters. The first of the bunch, Daredevil, landed in 2015 and brought a level of grit and believability to the genre and introduced its <a href="https://www.cinemablend.com/television/2562390/what-netflixs-daredevil-cast-is-doing-now-including-charlie-cox" data-original-url="https://www.cinemablend.com/television/2562390/what-netflixs-daredevil-cast-is-doing-now-including-charlie-cox">fair share of memorable characters</a> (and spinoffs) along the way. Even though the show was cancelled after only three seasons, it’s still one of the <a href="https://www.cinemablend.com/news/2494147/what-to-watch-on-netflix-if-you-love-superheroes" data-original-url="https://www.cinemablend.com/news/2494147/what-to-watch-on-netflix-if-you-love-superheroes">best superhero options on Netflix</a>.</p><p><a href="https://www.netflix.com/title/80018294"><strong>Stream</strong> <em><strong>Daredevil</strong></em> <strong>on Netflix.</strong></a></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="SgKHmvVtaymLyEMjUCNhaB" name="" alt="Timothy Olyphant and Drew Barrymore on Santa Clarita Diet" src="https://cdn.mos.cms.futurecdn.net/SgKHmvVtaymLyEMjUCNhaB.jpg" mos="https://cdn.mos.cms.futurecdn.net/SgKHmvVtaymLyEMjUCNhaB.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="santa-clarita-diet-2017-2019-3">Santa Clarita Diet (2017 - 2019)</h2><p>Zombie shows typically focus more on the horror elements than any humor, but Santa Clarita Diet isn’t your traditional show about the undead; hell, it’s not even a traditional comedy. Despite that, the horror-comedy starring Drew Barrymore as a suburban real estate agent with an appetite for human flesh and Timothy Olyphant as her husband stuck in the middle of the whole mess, was one of the most clever spins on the genre during it’s <a href="https://www.cinemablend.com/television/2469227/how-santa-clarita-diet-season-3-set-joel-and-sheilas-story-up-for-possible-season-4" data-original-url="https://www.cinemablend.com/television/2469227/how-santa-clarita-diet-season-3-set-joel-and-sheilas-story-up-for-possible-season-4">three-season run on Netflix</a>.</p><p><a href="https://www.netflix.com/title/80095815"><strong>Stream</strong> <em><strong>Santa Clarita Diet</strong></em> <strong>on Netflix.</strong></a></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="vL4Zzs7dGsVTPPVmQar9LX" name="" alt="lupin netflix" src="https://cdn.mos.cms.futurecdn.net/vL4Zzs7dGsVTPPVmQar9LX.jpg" mos="https://cdn.mos.cms.futurecdn.net/vL4Zzs7dGsVTPPVmQar9LX.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="lupin-2021-present">Lupin (2021 - Present)</h2><p>There have been countless adaptations of the classic French thief Arsène Lupin over the years, but the most recent take, Lupin, is honestly one of the best and most inventive of the bunch. Set in modern-day France, the Netflix crime thriller follows Assane Diop (Omar Sy), a man on a mission to get back at a wealthy and well-established family for an injustice they inflicted against his father. With more adventures on the way, now’s the perfect time to check out the first five chapters of the remarkable title.</p><p><a href="https://www.netflix.com/title/80994082"><strong>Stream</strong> <em><strong>Lupin</strong></em> <strong>on Netflix.</strong></a></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="CjkejwMgg6WjrVgRdDevkB" name="" alt="Kaitlyn Dever on Unbelievable" src="https://cdn.mos.cms.futurecdn.net/CjkejwMgg6WjrVgRdDevkB.jpg" mos="https://cdn.mos.cms.futurecdn.net/CjkejwMgg6WjrVgRdDevkB.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="unbelievable-2019">Unbelievable (2019)</h2><p>Based on the real-life story of a sexual assault victim and the local authorities who didn’t buy her story, 2019’s Unbelievable is a riveting, if not maddening, drama following a young woman in her darkest moments. One of the <a href="https://www.cinemablend.com/television/2481280/11-unbelievable-true-crime-series-worth-streaming-on-netflix" data-original-url="https://www.cinemablend.com/television/2481280/11-unbelievable-true-crime-series-worth-streaming-on-netflix">best true crime series streaming on Netflix</a>, <em>Unbelievable</em> is a truly remarkable piece of television and should be revisited for its lessons just as much, if not more than the drama that unfolds over the course of its narrative.</p><p><a href="https://www.netflix.com/title/80153467"><strong>Stream</strong> <em><strong>Unbelievable</strong></em> <strong>on Netflix.</strong></a></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="QYedfgWvAqbHASZ9c9ZKf3" name="" alt="Angela Bassett and Lena Waithe on Master of None" src="https://cdn.mos.cms.futurecdn.net/QYedfgWvAqbHASZ9c9ZKf3.jpg" mos="https://cdn.mos.cms.futurecdn.net/QYedfgWvAqbHASZ9c9ZKf3.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="master-of-none-2015-present">Master Of None (2015 - Present)</h2><p>One of the best shows you can binge over a single weekend, <em>Master of None</em> is honestly one of the best titles on Netflix. Created by star Aziz Ansari and Alan Yang, the show’s two seasons (with more on the way) make for some of the best television in recent memory, including the iconic episode “Thanksgiving” which earned Ansari and co-writer/co-star Lena Waithe a Primetime Emmy in 2017. Seriously, go back and watch that Season 2 barn burner of an episode.</p><p><a href="https://www.netflix.com/title/80049714"><strong>Stream</strong> <em><strong>Master Of None</strong></em> <strong>on Netflix.</strong></a></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="ivXzrWC37UM7UMDoYYS8o9" name="" alt="Daniel Kaluuya on Black Mirror" src="https://cdn.mos.cms.futurecdn.net/ivXzrWC37UM7UMDoYYS8o9.jpg" mos="https://cdn.mos.cms.futurecdn.net/ivXzrWC37UM7UMDoYYS8o9.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="black-mirror-2011-2019">Black Mirror (2011 - 2019)</h2><p>Being one of the few shows to be <a href="https://www.cinemablend.com/television/2557945/horror-tv-shows-stephen-king-praised-over-the-past-years" data-original-url="https://www.cinemablend.com/television/2557945/horror-tv-shows-stephen-king-praised-over-the-past-years">praised by Stephen King</a> should be enough to sell anyone on <em>Black Mirror</em>, but some could use more convincing. The long-running anthology horror/sci-fi series literally has something for everyone. From episodes that play out like <a href="https://www.cinemablend.com/television/2548523/ways-black-mirror-is-better-than-the-twilight-zone" data-original-url="https://www.cinemablend.com/television/2548523/ways-black-mirror-is-better-than-the-twilight-zone">unused <em>Twilight Zone</em> episodes</a> to those that seem like twisted versions of <em>Star Trek</em>, <a href="https://www.cinemablend.com/television/2486270/all-black-mirror-seasons-ranked-including-season-5" data-original-url="https://www.cinemablend.com/television/2486270/all-black-mirror-seasons-ranked-including-season-5">each installment</a> is amazing in its own, unique way. The show also served as a launching pad for some of today’s biggest stars.</p><p><a href="https://www.netflix.com/title/70264888"><strong>Stream</strong> <em><strong>Black Mirror</strong></em> <strong>on Netflix.</strong></a></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="Updhtx5yYfYtnR5GcfVFBB" name="" alt="Pedro Pascal on Narcos" src="https://cdn.mos.cms.futurecdn.net/Updhtx5yYfYtnR5GcfVFBB.jpg" mos="https://cdn.mos.cms.futurecdn.net/Updhtx5yYfYtnR5GcfVFBB.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="the-narcos-franchise-2015-present">The Narcos Franchise (2015 - Present)</h2><p>The gritty crime dramas Narcos and <em>Narcos: Mexico</em> are sprawling shows set in Colombia and Mexico, respectively, and follow some of television and history’s most notorious drug-lords. Fans of series like <em>Breaking Bad</em> and movies like <em>Sicario</em> will feel right at home with the franchise’s unapologetic approach to the subject matter.</p><p><a href="https://www.netflix.com/title/80025172"><strong>Stream</strong> <em><strong>Narcos</strong></em> <strong>on Netflix.</strong></a></p><p><a href="https://www.netflix.com/title/80997085"><strong>Stream</strong> <em><strong>Narcos: Mexico</strong></em> <strong>on Netflix.</strong></a></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="X7HQUMiP7nzkwR4smMJXmX" name="" alt="Amelie Bea Smith and Tahirah Sharif on The Haunting of Bly Manor" src="https://cdn.mos.cms.futurecdn.net/X7HQUMiP7nzkwR4smMJXmX.jpg" mos="https://cdn.mos.cms.futurecdn.net/X7HQUMiP7nzkwR4smMJXmX.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="the-haunting-franchise-2018-2020">The Haunting Franchise (2018 - 2020)</h2><p>Mike Flanagan has been making a strong case for being one of the greatest horror minds of all time with <em>Doctor Sleep</em> and his two Netflix supernatural stories The Haunting of Hill House and <em>The Haunting of Bly Manor</em>. Both of these two horror shows gave fans of the genre some of the best scares and family drama in recent memory, making everyone more than excited to see <a href="https://www.cinemablend.com/television/2562213/haunting-of-bly-manors-new-netflix-horror-show-has-cast-an-elm-street-legend-and-more" data-original-url="https://www.cinemablend.com/television/2562213/haunting-of-bly-manors-new-netflix-horror-show-has-cast-an-elm-street-legend-and-more">where Flanagan’s career</a> goes from here.</p><p><a href="https://www.netflix.com/title/80189221"><strong>Stream</strong> <em><strong>The Haunting Of Hill House</strong></em> <strong>on Netflix.</strong></a></p><p><a href="https://www.netflix.com/title/81237854"><strong>Stream</strong> <em><strong>The Haunting Of Bly Manor</strong></em> <strong>on Netflix</strong></a></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="wUptSgmeWApSvBuVR99qNf" name="" alt="BoJack Horseman (Will Arnett) questioning life's decisions on BoJack Horseman" src="https://cdn.mos.cms.futurecdn.net/wUptSgmeWApSvBuVR99qNf.jpg" mos="https://cdn.mos.cms.futurecdn.net/wUptSgmeWApSvBuVR99qNf.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="bojack-horseman-2014-2020-5">BoJack Horseman (2014 - 2020)</h2><p>Netflix has had its fair share of hits in the world of adult animation, but few compare to the Raphael Bob-Waksberg’s BoJack Horseman and its story about a humanoid horse (Will Arnett) who, despite being one of the biggest sitcom stars of all time, struggles to find a steady gig and his way in life all these years later. Who would have ever thought a cartoon about a self-loathing horse would be this much fun (or so heavy)?</p><p><a href="https://www.netflix.com/title/70300800"><strong>Stream</strong> <em><strong>BoJack Horseman</strong></em> <strong>on Netflix.</strong></a></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="LzonHYy2Y8pmAczif6pkCL" name="" alt="Melanie Lynskey on Easy" src="https://cdn.mos.cms.futurecdn.net/LzonHYy2Y8pmAczif6pkCL.jpg" mos="https://cdn.mos.cms.futurecdn.net/LzonHYy2Y8pmAczif6pkCL.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="easy-2016-2020">Easy (2016 - 2020)</h2><p>Created by writer/director Joe Swanberg, <em>Easy</em> was <a href="https://www.cinemablend.com/television/2470140/12-great-anthology-shows-you-can-stream-now" data-original-url="https://www.cinemablend.com/television/2470140/12-great-anthology-shows-you-can-stream-now">an anthology series</a> focusing on a diverse cast of characters in and around the greater Chicago area. Over the course of three seasons, the oftentimes hilarious, but always real, show touched on some of life’s most delicate topics and situations, as told by an all-star cast that included everyone from Dave Franco to Aubrey Plaza. Anyone familiar with Swanberg’s previous work (<em>Drinking Buddies</em>, <em>Happy Christmas</em>) knows what to expect here.</p><p><a href="https://www.netflix.com/title/80095699"><strong>Stream</strong> <em><strong>Easy</strong></em> <strong>on Netflix.</strong></a></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="QEqxoqSE8noxTeGvyf2Gim" name="" alt="orange is the new black netflix" src="https://cdn.mos.cms.futurecdn.net/QEqxoqSE8noxTeGvyf2Gim.jpg" mos="https://cdn.mos.cms.futurecdn.net/QEqxoqSE8noxTeGvyf2Gim.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="orange-is-the-new-black-2013-2019">Orange Is The New Black (2013 - 2019)</h2><p>One of the first big Netflix originals, Orange is the New Black broke a lot of ground for the streaming service and its push for original content upon its release in 2013. Over the years, the dramedy about life in a women’s prison introduced the world to some of TV’s most iconic characters and voices, including Laverne Cox, who stole every scene with her portrayal of Sophia Burset.</p><p><a href="https://www.netflix.com/title/70242311"><strong>Stream</strong> <em><strong>Orange Is The New Black</strong></em> <strong>on Netflix.</strong></a></p><p>This was just around 20 of the best Netflix original shows you can stream right now and there are plenty more where that came from. With countless other <a href="https://www.cinemablend.com/television/2558153/2021-winter-and-spring-tv-premiere-schedule-list-of-new-and-returning-shows" data-original-url="https://www.cinemablend.com/television/2558153/2021-winter-and-spring-tv-premiere-schedule-list-of-new-and-returning-shows">series premiering in 2021</a>, it is only a matter of time before we have make even more additions to this list.</p><div  class="fancy-box"><div class="fancy_box-title">Up next: <a href="https://www.cinemablend.com/television/2563648/could-the-queens-gambit-season-2-happen-on-netflix-heres-anna-taylor-joys-answer" data-original-url="https://www.cinemablend.com/television/2563648/could-the-queens-gambit-season-2-happen-on-netflix-heres-anna-taylor-joys-answer"><u><strong>Could The Queen's Gambit Season 2 Happen On Netflix? Here's Anya Taylor-Joy's Answer</strong></u></a></div><div class="fancy_box_body"><figure class="van-image-figure "  ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="" name="" caption="" alt="" src="https://img.cinemablend.com/quill/d/3/1/1/3/6/d31136d7e2391f012225e7cb1faafaf9a9753dc8.jpg" mos="" link="" align="" fullscreen="" width="0" height="0" attribution="" endorsement="" class="pinterest-pin-exclude"></p></div></div></figure></div></div>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ Survey Reveals Netflix Cancellations That Fans Are Most Upset About, But Daredevil Somehow Isn't On It ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/2559914/survey-reveals-netflix-cancellations-that-fans-are-most-upset-about-but-daredevil-somehow-isnt-on-it</link>
                                                                            <description>
                            <![CDATA[ This is a somewhat surprising list... ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">psMLR3kskUaJmGWL1Bq8XQ</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/CENBvLEZLVtZL8kMF9kUDX-1280-80.png" type="image/png" length="0"></enclosure>
                                                                        <pubDate>Wed, 09 Dec 2020 18:40:18 +0000</pubDate>                                                                                                                                <updated>Wed, 09 Dec 2020 22:49:47 +0000</updated>
                                                                                                                                            <category><![CDATA[Streaming News]]></category>
                                                                                                                    <dc:creator><![CDATA[ Adrienne Jones ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/ttBJtAZ7vqCe9Tp4BQiALo.png ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Adrienne Jones is a Senior Content Producer at CinemaBlend, and started at the site in the fall of 2015. In addition to writing and editing stories on a variety of different topics, she also spends her work days trying to find new ways to write about the many romantic entanglements that fictional characters find themselves in on TV shows. She graduated from Mizzou with a degree in Photojournalism.&amp;nbsp;&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What She&#039;s Into&lt;/strong&gt;: Adrienne will maintain until her dying day (and probably well after that, if possible) that 9 to 5 is one of the best movies ever made, though she also holds a special place in her heart for Auntie Mame, Office Space, and Bridesmaids. This may make it sound like her life and entertainment choices are only giggle-focused (not totally untrue), but she also enjoys warm-hearted dramadies (Gilmore Girls, Lovesick), creepy stuff (The X-Files, Evil), sci-fi/fantasy (most Star Treks, The Witcher), romantic shows (Bridgerton, Sweet Magnolias, Outlander), and the occasional drama (The Wire, Vikings: Valhalla). Adrienne likes cooking, but also ordering delivery so that strangers can be forced to bring her food, and believes that most days are incomplete without chocolate, reading, and staring out the window to see if any wild animals are engaging in shenanigans.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;Yennefer&#039;s apprentice, Gilmore Girl; will Vulcan nerve pinch pretty much anyone if prompted with cheese...Yes, even Jamie Fraser.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What She&#039;s Excited About Right Now&lt;/strong&gt;: Weather and raccoons that only come out at night!&lt;/p&gt; ]]></dc:description>
                                                                                                                                <cf:isSponsored>false</cf:isSponsored>
                <cf:hasAffiliateLinks>false</cf:hasAffiliateLinks>
                <cf:isPaid>false</cf:isPaid>
                                                                                                                                <media:content type="image/png" url="https://cdn.mos.cms.futurecdn.net/CENBvLEZLVtZL8kMF9kUDX-1280-80.png">
                                                            <media:credit><![CDATA[null]]></media:credit>
                                                                                                                                                                                                                                                                                                                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/CENBvLEZLVtZL8kMF9kUDX-1280-80.png" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <iframe src="https://content.jwplatform.com/players/VQ4kQh2q.html" id="VQ4kQh2q" title="Survey Reveals Netflix Cancellations That Fans Are Most Upset About, But Daredevil Somehow Isn't On It" width="600" height="338" frameborder="0" scrolling="auto" allowfullscreen></iframe><p>Netflix has grown exponentially over just the past few years, with <a href="https://www.cinemablend.com/television/2559844/netflix-and-shonda-rhimes-bridgerton-could-be-the-most-scandalous-period-drama-since-sanditon" data-original-url="https://www.cinemablend.com/television/2559844/netflix-and-shonda-rhimes-bridgerton-could-be-the-most-scandalous-period-drama-since-sanditon">dozens of new TV shows</a> being launched every year (fine, sometimes it's dozens <em>a month</em>). With all of that <a href="https://www.cinemablend.com/television/2559809/will-sweet-magnolias-season-2-be-ready-for-netflix-soon-heres-what-the-showrunner-says" data-original-url="https://www.cinemablend.com/television/2559809/will-sweet-magnolias-season-2-be-ready-for-netflix-soon-heres-what-the-showrunner-says">exciting growth and new content</a>, though, the streamer has begun to cancel projects with a regularity that has alarmed many subscribers, especially as shows which were thought to be fairly safe and had good buzz and / or <a href="https://www.cinemablend.com/television/2559789/how-virgin-rivers-showrunner-plans-to-handle-future-seasons-on-netflix" data-original-url="https://www.cinemablend.com/television/2559789/how-virgin-rivers-showrunner-plans-to-handle-future-seasons-on-netflix">dedicated viewership</a> continue to get the axe. A new survey has determined which shows Netflix fans are most upset about when it comes to all the cancellations, but, surprisingly, <em>Daredevil</em> didn't make the list.</p><p><a href="https://ardentgrowth.com/canceled-netflix-originals-study/">Ardent Growth</a> recently conducted a survey of 2,609 Netflix subscribers to see which of the many (<em>many</em>) recent-ish cancellations from the streamer have upset them the most, and while some of the titles listed among the Top 10 make complete sense, others will likely be a complete shock to you. According to the survey results, the Top 10 most missed Netflix shows are:</p><ol><li>Luke Cage – 71%</li><li>G.L.O.W – 61%</li><li>Santa Clarita Diet – 60%</li><li>The Punisher – 55%</li><li>Teenage Bounty Hunters – 52%</li><li>BoJack Horseman – 50%</li><li>The OA – 49%</li><li>Next in Fashion – 47%</li><li>Altered Carbon – 44%</li><li>Disjointed – 40%</li></ol><p>Hmmm...Alright, as mentioned above some of these shows are exactly the ones many of us would put on this list, even if we weren't fans of them ourselves. In August of 2019, Netflix <a href="https://www.cinemablend.com/television/2477600/the-oa-creator-responds-after-it-becomes-the-latest-series-to-be-cancelled-by-netflix" data-original-url="https://www.cinemablend.com/television/2477600/the-oa-creator-responds-after-it-becomes-the-latest-series-to-be-cancelled-by-netflix">cancelled the twisty, somewhat meta, sci-fi drama</a> <em>The OA</em> after only two seasons. Just a few short weeks later, the fan protest about the loss had reached a fever pitch which led many loyal viewers to call for everyone who was upset about their shows getting cancelled to #CancelNetflix, and give up their subscriptions to the service altogether. And, on September 10 of last year, <a href="https://www.cinemablend.com/television/2480288/why-many-netflix-subscribers-just-cancelled-their-accounts-this-week" data-original-url="https://www.cinemablend.com/television/2480288/why-many-netflix-subscribers-just-cancelled-their-accounts-this-week">many did exactly that</a>.</p><p>Two of the other series that the Netflix subscriber cancellation took place in honor of ranked in the Top 3 of the survey results: <em>Luke Cage</em> (which came in at an impressive #1) and <em>Santa Clarita Diet</em> (also placing very well at #3). While <em>Santa Clarita Diet</em> was cancelled after <a href="https://www.cinemablend.com/television/2469227/how-santa-clarita-diet-season-3-set-joel-and-sheilas-story-up-for-possible-season-4" data-original-url="https://www.cinemablend.com/television/2469227/how-santa-clarita-diet-season-3-set-joel-and-sheilas-story-up-for-possible-season-4">a Season 3 finale cliffhanger</a> and left a lot of extremely disappointed viewers, <em>Luke Cage</em>, along with <em>The Punisher</em>, was a part of <a href="https://www.cinemablend.com/television/2467535/why-the-cancelled-marvel-shows-should-time-jump-if-they-return" data-original-url="https://www.cinemablend.com/television/2467535/why-the-cancelled-marvel-shows-should-time-jump-if-they-return">the rash of Marvel shows</a> which were dumped by the streamer after several strong, much-buzzed-about seasons. And, those cancellations included <em>Daredevil</em>, which was <a href="https://www.cinemablend.com/television/2462462/daredevil-cancelled-by-netflix-after-three-seasons" data-original-url="https://www.cinemablend.com/television/2462462/daredevil-cancelled-by-netflix-after-three-seasons">ripped from us too soon</a> in November of 2018, after only three seasons.</p><p>The cancellation of <em>Daredevil</em>, which was the first of the Marvel Netflix shows to debut and one of the biggest fan / critic favorites, led to the big #SaveDaredevil campaign, which not only quickly attracted a ton of supporters (including stars of the show), but is still going strong and <a href="https://www.cinemablend.com/television/2559367/how-vincent-donofrio-is-still-trying-to-save-daredevil-two-years-after-cancellation" data-original-url="https://www.cinemablend.com/television/2559367/how-vincent-donofrio-is-still-trying-to-save-daredevil-two-years-after-cancellation">regularly posts updates</a> about the status of the currently-still-very cancelled superhero drama. So, how on earth did the cancellation of <em>Daredevil</em> not make this list?</p><p>The number of people surveyed isn't that large, but considering the fan outcry when we heard there would be no new adventures for the Devil of Hell's Kitchen, you'd think that enough of them would have spoken up about <em>Daredevil</em>. Meanwhile, shows like <em>G.L.O.W.</em>, <em>Teenage Bounty Hunters</em> and <em>BoJack Horseman</em> each also had shocking cancellations, with the two former shows being axed <a href="https://www.cinemablend.com/television/2556177/looks-like-netflix-is-even-canceling-shows-hit-top-10-list-glow-teenage-bounty-hunters" data-original-url="https://www.cinemablend.com/television/2556177/looks-like-netflix-is-even-canceling-shows-hit-top-10-list-glow-teenage-bounty-hunters">just a couple of months back</a>, so those disappointments will be very fresh in people's minds.</p><p>Whether or not you're surprised by the shows which did make this list, there's no doubt that all of us go through a certain amount of teeth-gnashing when one of our favorite series seems to be <a href="https://www.cinemablend.com/television/2483868/bojack-horsemans-creator-thinks-its-a-shame-that-netflix-changed-its-cancellation-policy" data-original-url="https://www.cinemablend.com/television/2483868/bojack-horsemans-creator-thinks-its-a-shame-that-netflix-changed-its-cancellation-policy">cut down in its prime</a>, so here's hoping we can get through a few months without that happening.</p><p>If you're looking for something new to watch, or want to see when an old favorite returns, check out our <a href="https://www.cinemablend.com/television/2549136/2020-fall-tv-premiere-schedule-list-of-new-and-returning-shows" data-original-url="https://www.cinemablend.com/television/2549136/2020-fall-tv-premiere-schedule-list-of-new-and-returning-shows">guide to fall TV</a> and see what's on tap for <a href="https://www.cinemablend.com/television/2558153/2021-winter-and-spring-tv-premiere-schedule-list-of-new-and-returning-shows" data-original-url="https://www.cinemablend.com/television/2558153/2021-winter-and-spring-tv-premiere-schedule-list-of-new-and-returning-shows">early next year</a>!</p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ BoJack Horseman Creator Talks Whether The Netflix Series Should Get A Spinoff ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/2553350/bojack-horseman-creator-talks-whether-the-netflix-series-should-get-a-spinoff</link>
                                                                            <description>
                            <![CDATA[ Raphael Bob-Waksberg was asked about a potential spinoff and he had an answer. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">cBik3sYaANZdwVJwwm1p49</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/9qRWd8JAZPTgjzgSHvCNdG-1280-80.png" type="image/png" length="0"></enclosure>
                                                                        <pubDate>Wed, 26 Aug 2020 18:47:43 +0000</pubDate>                                                                                                                                                                                                                                <category><![CDATA[Streaming News]]></category>
                                                                                                                    <dc:creator><![CDATA[ Britt Lawrence ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/nZc7U9xPWeMriqycZdeEEo.png ]]></dc:source>
                                                                <dc:description><![CDATA[ null ]]></dc:description>
                                                                                                                                <cf:isSponsored>false</cf:isSponsored>
                <cf:hasAffiliateLinks>false</cf:hasAffiliateLinks>
                <cf:isPaid>false</cf:isPaid>
                                                                                                                                <media:content type="image/png" url="https://cdn.mos.cms.futurecdn.net/9qRWd8JAZPTgjzgSHvCNdG-1280-80.png">
                                                            <media:credit><![CDATA[Netflix]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[BoJack Horseman Netflix]]></media:description>                                                            <media:text><![CDATA[BoJack Horseman Netflix]]></media:text>
                                <media:title type="plain"><![CDATA[BoJack Horseman Netflix]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/9qRWd8JAZPTgjzgSHvCNdG-1280-80.png" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p><em>BoJack Horseman</em> came to a close earlier this year when the second half of its sixth and final season bowed on Netflix at <a href="https://www.cinemablend.com/television/2486865/12-terrific-shows-coming-to-netflix-in-january-2020" data-original-url="https://www.cinemablend.com/television/2486865/12-terrific-shows-coming-to-netflix-in-january-2020">the end of January</a>. The series remains a critically acclaimed show which was equally beloved among fans, <a href="https://www.cinemablend.com/television/2475022/hulu-reveals-its-3-favorite-netflix-shows-and-wants-netflix-to-play-along" data-original-url="https://www.cinemablend.com/television/2475022/hulu-reveals-its-3-favorite-netflix-shows-and-wants-netflix-to-play-along">including those at Hulu</a>. When you consider all of that adoration, you have to wonder: Should it get a spinoff? <em>BoJack Horseman</em>’s creator has weighed in on the potential.</p><p>Of all the shows that <a href="https://www.cinemablend.com/television/2475976/all-the-netflix-shows-that-have-been-cancelled-in-2019-so-far" data-original-url="https://www.cinemablend.com/television/2475976/all-the-netflix-shows-that-have-been-cancelled-in-2019-so-far">Netflix cancelled recently</a>, <em>BoJack Horseman</em> still remains one of the most shocking for many fans. Aaron Paul, who voiced Todd Chavez on the animated series, revealed that Netflix decided to “<a href="https://www.cinemablend.com/television/2481223/why-is-netflixs-bojack-horseman-ending-aaron-paul-seems-to-have-a-different-explanation" data-original-url="https://www.cinemablend.com/television/2481223/why-is-netflixs-bojack-horseman-ending-aaron-paul-seems-to-have-a-different-explanation">close the curtains</a>” on <em>BoJack Horseman</em>. On the surface of things, it would make sense if Raphael Bob-Waksberg wanted to continue the series in a spinoff. Asked about one, Bob-Waksberg told <a href="https://collider.com/bojack-horseman-ending-finale-interview-raphael-bob-waksberg/">Collider</a>:</p><div><blockquote><p>I guess there have been conversations like, ‘Would you be interested in this?’ And my answer is, ‘No, I think we told a story with our characters, and perhaps there are more stories that could have been told with them, but that’s… we can leave that to everyone’s imagination.’ I think, obviously I’ve enjoyed working on Tuca & Bertie, which is not a spinoff and is similar in some ways and a very different world in other ways. They don’t exist in the same world, but I think there’s more you could do with animal characters. There’s more you could do with Hollywood satire. There’s more themes that you could explore from the show. But I think an official spinoff, I don’t really see the point honestly. I feel like we told the story and we explored this world.</p></blockquote></div><p>When it comes to a <em>BoJack Horseman</em> spinoff, Raphael Bob-Waksberg does not see the purpose for one. He is content with where his landmark show ended. Bob-Waksberg has been outspoken about the show and <a href="https://www.cinemablend.com/television/2483868/bojack-horsemans-creator-thinks-its-a-shame-that-netflix-changed-its-cancellation-policy" data-original-url="https://www.cinemablend.com/television/2483868/bojack-horsemans-creator-thinks-its-a-shame-that-netflix-changed-its-cancellation-policy">Netflix in the past</a>. So, if he wanted to do a spinoff, you would think he <a href="https://www.cinemablend.com/television/2487509/bojack-horseman-creator-has-some-blunt-thoughts-about-one-of-netflix-practices" data-original-url="https://www.cinemablend.com/television/2487509/bojack-horseman-creator-has-some-blunt-thoughts-about-one-of-netflix-practices">would say his piece</a>.</p><p>From the sound of things, Raphael Bob-Waksberg feels like <em>BoJack Horseman</em> explored its characters and their storylines thoroughly enough. Hence, Bob-Waksberg’s seeming peace in <a href="https://www.cinemablend.com/television/2490245/netflix-puts-out-video-of-cast-celebrating-end-of-bojack-horseman-after-cancelling-show" data-original-url="https://www.cinemablend.com/television/2490245/netflix-puts-out-video-of-cast-celebrating-end-of-bojack-horseman-after-cancelling-show">the celebratory video</a> marking the end of <em>BoJack Horseman</em>. That said, he also believes there is further room to dig into the various themes tackled by the series, including satirizing Hollywood. Continuing to discuss a potential spinoff, Bob-Waksberg said:</p><div><blockquote><p>You know, I think there might be opportunities to maybe reinterpret some stuff down the road, but I think it’s too early to really do that at the moment. If someone wanted to do the BoJack Horseman opera, that might be interesting to me. That’s a different enough thing. But I think anything that tries to take place in the canon of the show or is an extension of the narrative of the show without completely reinterpreting it, I don’t think I would be very interested in personally. But again, it doesn’t belong to me. Literally it belongs to Tornante. They could decide, ‘We want to reboot this property with a hip, young, new creator,’ and so it goes.</p></blockquote></div><p>There you have it. The decision to do a <em>BoJack Horseman</em> spinoff is actually out of Raphael Bob-Waksberg’s hands, as he explained that Tornante Television owns the show. As Bob-Waksberg points out, they could decide to move forward without him, a decision that would undoubtedly go over as controversial for fans. For his part, Bob-Waksberg <a href="https://www.cinemablend.com/television/2383602/bojack-horseman-creator-has-a-new-show-coming-but-not-for-netflix" data-original-url="https://www.cinemablend.com/television/2383602/bojack-horseman-creator-has-a-new-show-coming-but-not-for-netflix">is moving on</a>.</p><p>Raphael Bob-Waksberg and <em>BoJack Horseman</em>’s Kate Purdy currently have the Amazon Prime Original, <em>Undone</em>, which features <em>Alita: Battle Angel</em>’s Rosa Salazar. It is a vastly <a href="https://www.cinemablend.com/television/2474596/bojack-horseman-creators-new-amazon-show-undone-looks-like-nothing-else-on-tv" data-original-url="https://www.cinemablend.com/television/2474596/bojack-horseman-creators-new-amazon-show-undone-looks-like-nothing-else-on-tv">different type of television show</a> from <em>BoJack Horseman</em>. However, those who want to continue following Bob-Waksberg’s work should be curious to check it out, especially since a <em>BoJack Horseman</em> spinoff with him as a creator is off the table.</p><p>It has to be a tricky thing to say goodbye to the prospect of doing more in that world, for <em>BoJack Horseman</em>’s creator. He poured six or so years into the series, only to have Netflix cancel it, leading to the <a href="https://www.cinemablend.com/television/2487671/16-most-disappointing-tv-cancellations-of-2019" data-original-url="https://www.cinemablend.com/television/2487671/16-most-disappointing-tv-cancellations-of-2019">disappointment of many</a>. The silver lining for fans is that it sounds as though Raphael Bob-Waksberg got to tell all of the stories he wanted to during its run.</p><p>You can binge-watch <em>BoJack Horseman</em> in its entirety on Netflix along with <a href="https://www.cinemablend.com/television/2485936/2020-netflix-schedule-premiere-dates-for-new-and-returning-shows" data-original-url="https://www.cinemablend.com/television/2485936/2020-netflix-schedule-premiere-dates-for-new-and-returning-shows">newly arriving 2020</a> content. While you wait to see if a spinoff or anything of that sort ever comes about, check out <a href="https://www.cinemablend.com/television/2549136/2020-fall-tv-premiere-schedule-list-of-new-and-returning-shows" data-original-url="https://www.cinemablend.com/television/2549136/2020-fall-tv-premiere-schedule-list-of-new-and-returning-shows">this fall’s premieres</a>.</p><div  class="fancy-box"><div class="fancy_box-title">Up next: <a href="https://www.cinemablend.com/television/2490436/why-bojack-horseman-season-6-felt-like-a-fitting-ending-to-the-netflix-show" data-original-url="https://www.cinemablend.com/television/2490436/why-bojack-horseman-season-6-felt-like-a-fitting-ending-to-the-netflix-show"><u><strong>Why BoJack Horseman Season 6 Felt Like A Fitting Ending To The Netflix Show</strong></u></a></div><div class="fancy_box_body"><figure class="van-image-figure "  ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="" name="" caption="" alt="" src="https://img.cinemablend.com/quill/d/b/b/9/f/9/dbb9f9a779706a3d3fead46558064c372c1b2b2b.jpg" mos="" link="" align="" fullscreen="" width="0" height="0" attribution="" endorsement="" class="pinterest-pin-exclude"></p></div></div></figure></div></div>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ 2020 Netflix Schedule: Premiere Dates For New And Returning TV Shows ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/2485936/2020-netflix-schedule-premiere-dates-for-new-and-returning-shows</link>
                                                                            <description>
                            <![CDATA[ Netflix continues to pump out tons of original TV shows of all kinds, and 2020 will no doubt features some of the streaming service's coolest shows yet. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">53iuWyLCNh6nN7DPhg1Rou</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/ZeiqZ5FWCynadEDN7WsUAh-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Sat, 01 Aug 2020 00:35:00 +0000</pubDate>                                                                                                                                <updated>Tue, 24 Nov 2020 16:32:08 +0000</updated>
                                                                                                                                            <category><![CDATA[Streaming News]]></category>
                                                                                                                    <dc:creator><![CDATA[ Nick Venable ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/TzeQjfZT5cKqHRsEqudtqT.png ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Nick Venable is an Assistant Managing Editor, and the TV Editor. His humble origin story with CinemaBlend began all the way back in the pre-streaming era, circa 2009, as a freelancing DVD reviewer and TV recapper. After rising up through the ranks covering Movies, Nick leapfrogged over to the small screen to cover more and more television news and interviews, eventually taking over the section for the current era. Born in Louisiana and currently living in Texas — Who Dat Nation over America’s Team all day, all night — Nick spent several years in the hospitality industry, and also worked as a 911 operator. And if you ever happened to hear his music or read his comics/short stories, you have his sympathy. His love for his wife and daughters is almost equaled by his love of gasp-for-breath laughter and gasp-for-breath horror. A lifetime spent in the vicinity of a television screen led to his current dream job, as well as his knowledge of too many TV themes and ad jingles.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What He&#039;s Into&lt;/strong&gt;: Nick is one of those people who won’t necessarily insert a Monty Python reference into every conversation, but is still mentally equipped to do so. Beyond such appreciation for surreal UK comedy, Nick also indulges in as much horror splendor as possible, from Stephen King novels to James Tynion IV comics to Freddy Krueger one-liners to all things Mike Flanagan. Throw in a dash of NFL, some 311 and Weird Al, fried crawfish poboys, bourbon, ‘90s-era pro wrestling, crossword puzzles and mystery-driven video games, and baby, you got a stew going. (Nick will insert an Arrested Development reference into every conversation, if possible.)&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What He&#039;s Excited About&lt;/strong&gt;: Anything Jeff Lemire, Tom King and W. Maxwell Prince think of, ever. More of Kelly Reilly’s deliriously fierce performances on Yellowstone. HBO’s The Last of Us. Clone High’s return. Colin Farrell’s Penguin being in every movie/TV show/breakfast cereal.&lt;/p&gt; ]]></dc:description>
                                                                                                                                <cf:isSponsored>false</cf:isSponsored>
                <cf:hasAffiliateLinks>false</cf:hasAffiliateLinks>
                <cf:isPaid>false</cf:isPaid>
                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/ZeiqZ5FWCynadEDN7WsUAh-1280-80.jpg">
                                                            <media:credit><![CDATA[null]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[lucifer smiling season 4]]></media:description>                                                            <media:text><![CDATA[lucifer smiling season 4]]></media:text>
                                <media:title type="plain"><![CDATA[lucifer smiling season 4]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/ZeiqZ5FWCynadEDN7WsUAh-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="5gj5hDxygecUZ7JqXGfd8k" name="" alt="sex education gillian anderson" src="https://cdn.mos.cms.futurecdn.net/5gj5hDxygecUZ7JqXGfd8k.jpg" mos="https://cdn.mos.cms.futurecdn.net/5gj5hDxygecUZ7JqXGfd8k.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><p>Despite the new and impending arrivals of such <a href="https://www.cinemablend.com/television/2475630/will-disney-beat-netflix-in-the-streaming-wars" data-original-url="https://www.cinemablend.com/television/2475630/will-disney-beat-netflix-in-the-streaming-wars?pv=search">powerhouse streaming services as Disney+</a>, HBO Max and Peacock, the world of quality streaming media still belongs squarely to Netflix, and the company is showing no signs of backing down from pressure. In fact, 2020 will be another breakthrough year for Netflix, with a slew of big-budget shows to complement its growing number of less-pricy projects.</p><p>With follow-up seasons to popular shows such as <em>Stranger Things</em> and <em>13 Reasons Why</em>, 2020 is going to be a huge year for Netflix, which will also boost up its feature side with <a href="https://www.cinemablend.com/news/2481480/whoa-eddie-murphy-is-working-on-beverly-hills-cop-4" data-original-url="https://www.cinemablend.com/news/2481480/whoa-eddie-murphy-is-working-on-beverly-hills-cop-4">Eddie Murphy's long-awaited <em>Beverly Hills Cop 4</em></a> and other noteworthy acquisitions. Combine those with lots of big-named comedy specials, killer docu-series and franchise-connecting animated series, and there might be little time to focus on other streaming services in 2020.</p><p>Check out our monthly rundown below, noting that all release times are at 3:01 a.m. ET (12:01 a.m. PT), and that all brand new series will be listed in ALL CAPS.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="SbdvpZt5nf5WtojD7d8KHi" name="" alt="bojack horseman and princess carolyn" src="https://cdn.mos.cms.futurecdn.net/SbdvpZt5nf5WtojD7d8KHi.jpg" mos="https://cdn.mos.cms.futurecdn.net/SbdvpZt5nf5WtojD7d8KHi.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="january-2020-netflix-premieres">January 2020 Netflix Premieres</h2><p>To kick off the new year, Netflix is bringing the final seasons for two of its popular shows: the long-running <em>BoJack Horseman</em>, which will wrap up the final episodes of Season 6, and <em>Anne with an E</em>, which was <a href="https://www.cinemablend.com/television/2485603/fans-are-devastated-after-surprise-netflix-cancellation-of-anne-with-an-e" data-original-url="https://www.cinemablend.com/television/2485603/fans-are-devastated-after-surprise-netflix-cancellation-of-anne-with-an-e">recently cancelled ahead of its Season 3 premiere</a>. But those aren't the only ones out there, of course, so check out what else is coming.</p><p><strong><strong>Wednesday, January 1</strong></strong></p><p><strong>THE CIRCLE</strong></p><p><strong>MESSIAH</strong></p><p><strong>NISMAN: THE PROSECUTOR, THE PRESIDENT AND THE SPY</strong></p><p><strong>SPINNING OUT</strong></p><p><strong><strong>Thursday, January 2</strong></strong></p><p><strong>THIEVES OF THE WOOD</strong></p><p><strong><strong>Friday, January 3</strong></strong></p><p><a href="https://www.cinemablend.com/television/2485670/could-cancelled-anne-with-an-e-get-a-movie-to-wrap-up" data-original-url="https://www.cinemablend.com/television/2485670/could-cancelled-anne-with-an-e-get-a-movie-to-wrap-up"><strong>Anne with an E</strong> Season 3</a></p><p><strong><strong>Saturday, January 4</strong></strong></p><p><strong>DRACULA</strong></p><p><strong>GO! GO! CORY CARSON</strong></p><p><strong><strong>Wednesday, January 8</strong></strong></p><p><strong>CHEER</strong></p><p><strong><strong>Friday, January 10</strong></strong></p><p><strong>AJ AND THE QUEEN</strong></p><p><strong>MEDICAL POLICE</strong></p><p><strong>GIRI/HAJI</strong></p><p><strong>JAMTARA: SABKA NUMBER AYEGA</strong></p><p><strong>Harvey Girls Forever!</strong> Season 4</p><p><strong>The Inbestigators</strong> Season 2</p><p><strong>Zumbo's Just Desserts</strong> Season 2</p><p><strong><strong>Monday, January 13</strong></strong></p><p><strong>THE HEALING POWERS OF DUDE</strong></p><p><strong><strong>Tuesday, January 14</strong></strong></p><p><strong>KIPO AND THE AGE OF WONDERBEASTS</strong></p><p><strong>LESLIE JONES: TIME MACHINE</strong></p><p><strong><strong>Wednesday, January 15</strong></strong></p><p><strong>Grace & Frankie</strong> Season 6</p><p><strong>KILLER INSIDE: THE MIND OF AARON HERNANDEZ</strong></p><p><strong><strong>Friday, January 17</strong></strong></p><p><a href="https://www.cinemablend.com/television/2464952/sex-education-review-netflixs-raunchy-new-comedy-is-surprisingly-sweet-and-hilarious" data-original-url="https://www.cinemablend.com/television/2464952/sex-education-review-netflixs-raunchy-new-comedy-is-surprisingly-sweet-and-hilarious"><strong>Sex Education</strong> Season 2</a></p><p><strong>Hip Hop Evolution</strong> Season 4</p><p><strong>ARES</strong></p><p><strong>NAILED IT! GERMANY</strong></p><p><strong><strong>Monday, January 20</strong></strong></p><p><strong>Family Reunion</strong> Part 2</p><p><strong><strong>Tuesday, January 21</strong></strong></p><p><strong>FORTUNE FEIMSTER: SWEET & SALTY</strong></p><p><strong>Jim Henson's Word Party</strong> Season 4</p><p><strong><strong>Wednesday, January 22</strong></strong></p><p><strong>PANDEMIC: HOW TO PREVENT AN OUTBREAK</strong></p><p><strong><strong>Thursday, January 23</strong></strong></p><p><strong>GHOST BRIDE</strong></p><p><strong>OCTOBER FACTION</strong></p><p><strong>Saint Seiya: Knights of the Zodiac</strong> Part 2</p><p><strong><strong>Friday, January 24</strong></strong></p><p><strong>Chilling Adventures of Sabrina</strong> Season 2 Part 1</p><p><strong>The Ranch</strong> Season 4 Part 2</p><p><strong>RISE OF EMPIRES: OTTOMAN</strong></p><p><strong><strong>Tuesday, January 28</strong></strong></p><p><strong>ALEX FERNÁNDEZ: EL MEJOR COMEDIANTE DEL MUNDO</strong></p><p><strong><strong>Wednesday, January 29</strong></strong></p><p><strong>NEXT IN FASHION</strong></p><p><strong>NIGHT ON EARTH</strong></p><p><strong>OMNISCIENT</strong></p><p><strong><strong>Thursday, January 30</strong></strong></p><p><strong>AINORI LOVE WAGON: AFRICAN JOURNEY</strong></p><p><strong>THE STRANGER</strong></p><p><strong><strong>Friday, January 31</strong></strong></p><p><a href="https://www.cinemablend.com/television/2481223/why-is-netflixs-bojack-horseman-ending-aaron-paul-seems-to-have-a-different-explanation" data-original-url="https://www.cinemablend.com/television/2481223/why-is-netflixs-bojack-horseman-ending-aaron-paul-seems-to-have-a-different-explanation"><strong>BoJack Horseman</strong> Season 6 Part 2</a></p><p><strong>RAGNAROK</strong></p><p><strong>Diablero</strong> Season 2</p><p><strong>I Am a Killer</strong> Season 2</p><p><strong>LUNA NERA</strong></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="edghmSsGokUnwAwA33AuLK" name="" alt="locke and key poster netflix tv show" src="https://cdn.mos.cms.futurecdn.net/edghmSsGokUnwAwA33AuLK.png" mos="https://cdn.mos.cms.futurecdn.net/edghmSsGokUnwAwA33AuLK.png" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="february-2020-netflix-premieres">February 2020 Netflix Premieres</h2><p>February is usually one of the poorest months for big screen fare, with weather issues also playing into the reasons why it's often better to just sit back on the couch and stream. Netflix will no doubt have customers glued to their seats when February starts, with the long-awaited debut of Joe Hill and Gabriel Rodriguez's masterpiece comic series <em>Locke & Key</em> debuting after a nine-year multimedia struggle.</p><p><strong><strong>Tuesday, February 4</strong></strong></p><p><strong>TOM PAPA: YOU'RE DOING GREAT</strong></p><p><strong><strong>Wednesday, February 5</strong></strong></p><p><strong>THE PHARMACIST</strong></p><p><strong>THEY'VE GOTTA HAVE US</strong></p><p><strong><strong>Thursday, February 6</strong></strong></p><p><strong>CAGASTER OF AN INSECT CAGE</strong></p><p><strong><strong>Friday, February 7</strong></strong></p><p><strong>Dreamworks Dragons: Rescue Riders</strong> Season 2</p><p><a href="https://www.cinemablend.com/television/2466452/locke-and-key-an-updated-cast-list" data-original-url="https://www.cinemablend.com/television/2466452/locke-and-key-an-updated-cast-list"><strong>LOCKE & KEY</strong></a></p><p><strong>MY HOLO LOVE</strong></p><p><strong><strong>Sunday, February 9</strong></strong></p><p><strong>THE EPIC TALES OF CAPTAIN UNDERPANTS: EPIC CHOICE-O-RAMA</strong></p><p><strong><strong>Thursday, February 13</strong></strong></p><p><strong>Narcos: Mexico</strong> Season 2</p><p><strong>LOVE IS BLIND</strong></p><p><strong><strong>Friday, February 14</strong></strong></p><p><strong>Cable Girls</strong> Season 5 Part 1</p><p><strong><strong>Wednesday, February 19</strong></strong></p><p><strong>The Chef Show</strong> Season 3</p><p><strong><strong>Thursday, February 27</strong></strong></p><p><strong>FOLLOWERS</strong></p><p><strong><strong>Thursday, February 20</strong></strong></p><p><strong>SPECTROS</strong></p><p><strong><strong>Friday, February 21</strong></strong></p><p><strong>GENTEFIED</strong></p><p><strong>GLITCH TECHS</strong></p><p><strong>BABIES</strong></p><p><strong>PUERTA 7</strong></p><p><strong>HYENA</strong></p><p><strong><strong>Tuesday, February 25</strong></strong></p><p><strong>PETE DAVIDSON: ALIVE FROM NEW YORK</strong></p><p><strong><strong>Wednesday, February 26</strong></strong></p><p><strong>I AM NOT OKAY WITH THIS</strong></p><p><strong>THE TRIALS OF GABRIEL FERNANDEZ</strong></p><p><strong><strong>Thursday, February 27</strong></strong></p><p><strong>Altered Carbon</strong> Season 2</p><p><strong>FOLLOWERS</strong></p><p><strong><strong>Friday, February 28</strong></strong></p><p><strong>Babylon Berlin</strong> Season 3</p><p><strong>Always a Witch</strong> Season 2</p><p><strong>Formula 1: Drive to Survive Season 2</strong></p><p><strong>QUEEN SONO</strong></p><p><strong>RESTAURANTS ON THE EDGE</strong></p><p><strong>AMIT TANDON: FAMILY TANDONCIES</strong></p><p><strong>UNSTOPPABLE</strong></p><p><strong>TOY BOY</strong></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="X27wNUp3GiqaxhU3LyPJmY" name="" alt="kingdom netflix" src="https://cdn.mos.cms.futurecdn.net/X27wNUp3GiqaxhU3LyPJmY.jpg" mos="https://cdn.mos.cms.futurecdn.net/X27wNUp3GiqaxhU3LyPJmY.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="march-2020-netflix-premieres">March 2020 Netflix Premieres</h2><p><strong><strong>Tuesday, March 3</strong></strong></p><p><a href="https://www.youtube.com/watch?v=9Dcw0IiL5sY&feature=emb_title"><strong>TAYLOR TOMLINSON: QUARTER-LIFE CRISIS</strong></a></p><p><strong><strong>Thursday, March 5</strong></strong></p><p><strong>Castlevania</strong> Season 3</p><p><strong><strong>Friday, March 6</strong></strong></p><p><strong>Paradise PD Season 2</strong></p><p><strong>The Protector Season 3</strong></p><p><strong>Ugly Delicious Season 2</strong></p><p><strong><strong>Tuesday, March 10</strong></strong></p><p><strong>CARMEN SANDIEGO: TO STEAL OR NOT TO STEAL</strong></p><p><strong>MARC MARON: END TIMES FUN</strong></p><p><strong><strong>Wednesday, March 11</strong></strong></p><p><strong>Dirty Money</strong> Season 2</p><p><strong>On My Block</strong> Season 3</p><p><strong><strong>Thursday, March 12</strong></strong></p><p><strong>HOSPITAL PLAYLIST</strong></p><p><strong><strong>Friday, March 13</strong></strong></p><p><strong>Kingdom</strong> Season 2</p><p><strong>Elite Season 3</strong></p><p><strong>100 HUMANS</strong></p><p><strong>BLOODRIDE</strong></p><p><strong>VALHALLA MURDERS</strong></p><p><strong>WOMEN OF THE NIGHT</strong></p><p><strong>BEASTARS</strong></p><p><strong><strong>Monday, March 16</strong></strong></p><p><strong>The Boss Baby: Back In Business</strong> Season 3</p><p><strong><strong>Tuesday, March 17</strong></strong></p><p><strong>BERT KREISCHER: HEY BIG BOY</strong></p><p><strong>SHAUN THE SHEEP: ADVENTURES FROM MOSSY BOTTOM</strong></p><p><strong><strong>Thursday, March 19</strong></strong></p><p><strong>ALTERED CARBON: RESLEEVED</strong></p><p><strong>FEEL GOOD</strong></p><p><strong><strong>Friday, March 20</strong></strong></p><p><strong>Archibald's Next Big Thing</strong> Season 2</p><p><strong>SELF MADE: INSPIRED BY THE LIFE OF MADAM C.J. WALKER</strong></p><p><strong>TIGER KING</strong></p><p><strong>LETTER FOR THE KING</strong></p><p><strong><strong>Monday, March 23</strong></strong></p><p><strong>FREUD</strong></p><p><strong>SOL LEVANTE</strong></p><p><strong><strong>Thursday, March 26</strong></strong></p><p><strong>7Seeds</strong> Season 2</p><p><strong>UNORTHODOX</strong></p><p><strong><strong>Friday, March 27</strong></strong></p><p><strong>Ozark</strong> Season 3</p><p><strong>Car Masters: Rags To Riches</strong> Season 2</p><p><strong>DREAMWORKS DRAGONS: RIDERS RESCUE: HUNT FOR THE GOLDEN DRAGON</strong></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="dopMKBHTQQcNN3JxutcUSE" name="" alt="ricky gervais' tony dancing with lisa in after life season 2" src="https://cdn.mos.cms.futurecdn.net/dopMKBHTQQcNN3JxutcUSE.jpg" mos="https://cdn.mos.cms.futurecdn.net/dopMKBHTQQcNN3JxutcUSE.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: netflix press)</span></figcaption></figure><h2 id="april-2020-netflix-premieres">April 2020 Netflix Premieres</h2><p><strong><strong>Wednesday, April 1</strong></strong></p><p><strong>DAVID BATRA: ELEFANTEN I RUMMET</strong></p><p><strong>THE ILIZA SHLESINGER SKETCH SHOW</strong></p><p><strong>HOW TO FIX A DRUG SCANDAL</strong></p><p><strong>Nailed It</strong> Season 4</p><p><strong>Sunderland 'Til I Die</strong> Season 2</p><p><strong><strong>Friday, April 3</strong></strong></p><p><strong>La Casa De Papel</strong> Season 4</p><p><strong>MONEY HEIST: THE PHENOMENON</strong></p><p><strong>SPIRIT RIDING FREE: RIDING ACADEMY</strong></p><p><strong>STARBEAM</strong></p><p><strong><strong>Friday, April 6</strong></strong></p><p><strong>THE BIG SHOW SHOW</strong></p><p><strong><strong>Saturday, April 7</strong></strong></p><p><strong>Terrace House: Tokyo 2019-2020</strong> Part 3</p><p><strong><strong>Thursday, April 9</strong></strong></p><p><strong>Hi Score Girl</strong> Season 2</p><p><strong><strong>Friday, April 10</strong></strong></p><p><strong>BREWS BROTHERS</strong></p><p><strong><strong>Tuesday, April 14</strong></strong></p><p><strong>CHRIS D'ELIA: NO PAIN</strong></p><p><strong><strong>Wednesday, April 15</strong></strong></p><p><strong>THE INNOCENCE FILES</strong></p><p><strong>OUTER BANKS</strong></p><p><strong><strong>Thursday, April 16</strong></strong></p><p><strong>Fary: Hexagone</strong> Season 2</p><p><strong>Fauda</strong> Season 3</p><p><strong>MAURICIO MEIRELLES: LEVANDO O CAOS</strong></p><p><strong><strong>Friday, April 17</strong></strong></p><p><strong>#BLACKAF</strong></p><p><strong>The Last Kids on Earth: Book 2</strong> (Season 2)</p><p><strong>TOO HOT TO HANDLE</strong></p><p><strong><strong>Monday, April 20</strong></strong></p><p><strong>COOKING WITH CANNABIS</strong></p><p><strong>THE MIDNIGHT GOSPEL</strong></p><p><strong><strong>Tuesday, April 21</strong></strong></p><p><strong>MIDDLEDITCH & SCHWARTZ</strong></p><p><strong><strong>Wednesday, April 22</strong></strong></p><p><strong>ABSURD PLANET</strong></p><p><strong>WIN THE WILDERNESS</strong></p><p><strong><strong>Thursday, April 23</strong></strong></p><p><strong>The House of Flowers</strong> Season 3</p><p><strong><strong>Friday, April 24</strong></strong></p><p><strong>After Life</strong> Season 2</p><p><strong>YOURS SINCERELY, KANAN GILL</strong></p><p><strong>Hello Ninja</strong> Season 2</p><p><strong><strong>Sunday, April 26</strong></strong></p><p><strong>The Last Kingdom</strong> Season 4</p><p><strong><strong>Monday, April 27</strong></strong></p><p><strong>NEVER HAVE I EVER</strong></p><p><strong><strong>Wednesday, April 29</strong></strong></p><p><strong>EXTRACURRICULAR</strong></p><p><strong>NADIYA'S TIME TO EAT</strong></p><p><strong>SUMMERTIME</strong></p><p><strong><strong>Thursday, April 30</strong></strong></p><p><strong>DRIFTING DRAGONS</strong></p><p><strong>THE FOREST OF LOVE: DEEP CUT</strong></p><p><strong>THE VICTIM'S GAME</strong></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="PeicBZhtrWUt2qArzpYJzg" name="" alt="space force steve carrell and john malkovich" src="https://cdn.mos.cms.futurecdn.net/PeicBZhtrWUt2qArzpYJzg.jpg" mos="https://cdn.mos.cms.futurecdn.net/PeicBZhtrWUt2qArzpYJzg.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="may-2020-netflix-premieres">May 2020 Netflix Premieres</h2><p><strong><strong>Friday, May 1</strong></strong></p><p><a href="https://www.cinemablend.com/television/2493807/first-look-at-jim-parsons-darren-criss-and-more-in-netflixs-hollywood" data-original-url="https://www.cinemablend.com/television/2493807/first-look-at-jim-parsons-darren-criss-and-more-in-netflixs-hollywood"><strong>HOLLYWOOD</strong></a></p><p><strong>ALMOST HAPPY</strong></p><p><strong>Go! Go! Cory Carson: The Chrissy</strong> (Special)</p><p><strong>INTO THE NIGHT</strong></p><p><strong>Medici: The Magnificent</strong> Season 3</p><p><strong>RECKONING</strong> (U.S. Premiere)</p><p><strong><strong>Tuesday, May 5</strong></strong></p><p><strong>JERRY SEINFELD: 23 HOURS TO KILL</strong></p><p><strong><strong>Wednesday, May 6</strong></strong></p><p><strong>Workin' Moms</strong> Season 4</p><p><strong><strong>Thursday, May 7</strong></strong></p><p><strong>Scissor Seven</strong> Season 2</p><p><strong><strong>Friday, May 8</strong></strong></p><p><a href="https://www.cinemablend.com/television/2482734/netflixs-dead-to-me-season-2-is-adding-a-santa-clarita-diet-alum" data-original-url="https://www.cinemablend.com/television/2482734/netflixs-dead-to-me-season-2-is-adding-a-santa-clarita-diet-alum"><strong>Dead to Me</strong> Season 2</a></p><p><strong>THE EDDY</strong></p><p><strong>The Hollow</strong> Season 2</p><p><strong>Restaurants on the Edge</strong> Season 2</p><p><strong>Rust Valley Restorers</strong> Season 2</p><p><strong>VALERIA</strong></p><p><strong><strong>Monday, May 11</strong></strong></p><p><strong>TRIAL BY MEDIA</strong></p><p><strong>Bordertown</strong> Season 3</p><p><strong><strong>Tuesday, May 12</strong></strong></p><p><strong>Unbreakable Kimmy Schmidt: Kimmy Vs. the Reverend</strong> (Interactive Special)</p><p><strong>TRUE: TERRIFIC TALES</strong></p><p><strong><strong>Friday, May 15</strong></strong></p><p><strong>She-Ra and the Princesses of Power</strong> Season 5</p><p><strong>Magic for Humans</strong> Season 3</p><p><strong>CHICHIPATOS</strong></p><p><strong>INHUMAN RESOURCES</strong></p><p><strong>WHITE LINES</strong></p><p><strong><strong>Saturday, May 16</strong></strong></p><p><strong>LA REINA DE INDIAS Y EL CONQUISTADOR</strong></p><p><strong><strong>Monday, May 18</strong></strong></p><p><strong>THE BIG FLOWER FIGHT</strong></p><p><strong><strong>Tuesday, May 19</strong></strong></p><p><strong>PATTON OSWALT: I LOVE EVERYTHING</strong></p><p><strong>SWEET MAGNOLIAS</strong></p><p><strong><strong>Wednesday, May 20</strong></strong></p><p><strong>BEN PLATT LIVE FROM RADIO CITY MUSIC HALL</strong></p><p><strong><strong>Friday, May 22</strong></strong></p><p><strong>Trailer Park Boys: The Animated Series</strong> Season 2</p><p><strong>Selling Sunset</strong> Season 2</p><p><strong>CONTROL Z</strong></p><p><strong>HISTORY 101</strong></p><p><strong><strong>Tuesday, May 26</strong></strong></p><p><strong>HANNAH GADSBY: DOUGLAS</strong></p><p><strong><strong>Friday, May 29</strong></strong></p><p><a href="https://www.cinemablend.com/television/2443329/somebody-feed-phils-host-shares-how-to-eat-on-tv-without-overdoing-it" data-original-url="https://www.cinemablend.com/television/2443329/somebody-feed-phils-host-shares-how-to-eat-on-tv-without-overdoing-it"><strong>Somebody Feed Phil</strong></a> Season 3</p><p><a href="https://www.cinemablend.com/television/2465261/steve-carrell-is-reuniting-with-the-office-creator-for-a-new-netflix-show" data-original-url="https://www.cinemablend.com/television/2465261/steve-carrell-is-reuniting-with-the-office-creator-for-a-new-netflix-show"><strong>SPACE FORCE</strong></a></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="XNX3WH5TNGHPhYKVDQXx9b" name="" alt="fuller house season 5 stephanie and D.J. in the kitchen" src="https://cdn.mos.cms.futurecdn.net/XNX3WH5TNGHPhYKVDQXx9b.jpg" mos="https://cdn.mos.cms.futurecdn.net/XNX3WH5TNGHPhYKVDQXx9b.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="june-2020-netflix-premieres">June 2020 Netflix Premieres</h2><p><strong><strong>Tuesday, June 2</strong></strong></p><p><strong>Fuller House</strong> Season 5 Part 2</p><p><strong><strong>Thursday, June 4</strong></strong></p><p><strong>Baki</strong> Season 3</p><p><strong>CAN YOU HEAR ME?</strong></p><p><strong><strong>Friday, June 5</strong></strong></p><p><strong>13 Reasons Why</strong> Season 4</p><p><strong>Queer Eye</strong> Season 5</p><p><strong><strong>Wednesday, June 10</strong></strong></p><p><strong>LENOX HILL</strong></p><p><strong>CURON</strong></p><p><strong>REALITY Z</strong></p><p><strong><strong>Thursday, June 11</strong></strong></p><p><strong>WHISPERS</strong></p><p><strong><strong>Friday, June 12</strong></strong></p><p><strong>F is for Family</strong> Season 4</p><p><strong>Pokémon The Series: Sun & Moon</strong> Season 23</p><p><strong>Kipo and the Age of Wonderbeasts</strong> Season 2</p><p><strong>Dating Around</strong> Season 2</p><p><strong>Crime Diaries</strong> Season 3</p><p><strong>THE WOODS</strong></p><p><strong>FRANK ELSTNER: JUST ONE LAST QUESTION</strong></p><p><strong><strong>Saturday, June 13</strong></strong></p><p><strong>Alexa & Katie</strong> Season 3 Part 2</p><p><strong><strong>Sunday, June 14</strong></strong></p><p><strong>Marcella</strong> Season 3</p><p><strong><strong>Tuesday, June 16</strong></strong></p><p><strong>EXPLAINED: CORONAVIRUS: THE RACE FOR A VACCINE</strong></p><p><strong><strong>Wednesday, June 17</strong></strong></p><p><strong>Mr. Iglesias</strong> Season 2</p><p><strong><strong>Thursday, June 18</strong></strong></p><p><strong>The Order</strong> Season 2</p><p><strong><strong>Friday, June 19</strong></strong></p><p><strong>The Politician</strong> Season 2</p><p><strong>Babies</strong> Season 2</p><p><strong>Most Beautiful Thing</strong> Season 2</p><p><a href="https://www.cinemablend.com/television/2548609/why-netflixs-floor-is-lava-is-a-perfect-binge-for-anybody-who-grew-up-on-nickelodeon-game-shows" data-original-url="https://www.cinemablend.com/television/2548609/why-netflixs-floor-is-lava-is-a-perfect-binge-for-anybody-who-grew-up-on-nickelodeon-game-shows"><strong>FLOOR IS LAVA</strong></a></p><p><strong><strong>Tuesday, June 23</strong></strong></p><p><strong>ERIC ANDRE: LEGALIZE EVERYTHING</strong></p><p><strong><strong>Wednesday, June 24</strong></strong></p><p><strong>CRAZY DELICIOUS</strong></p><p><strong>Lenox Hill: Pandemic (Special Presentation)</strong></p><p><strong><strong>Friday, June 26</strong></strong></p><p><strong>AMAR Y VIVIR</strong></p><p><strong>HOME GAME</strong></p><p><strong>TWOGETHER</strong></p><p><strong><strong>Saturday, June 27</strong></strong></p><p><strong>Dark</strong> Season 3</p><p><strong><strong>Tuesday, June 30</strong></strong></p><p><strong>GEORGE LOPEZ: WE'LL DO IT FOR HALF</strong></p><p><strong>BNA: BRAND NEW ANIMAL</strong></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="CTbznnBCQPJsyjTKvom6zA" name="" alt="the umbrella academy season 2 vanya light" src="https://cdn.mos.cms.futurecdn.net/CTbznnBCQPJsyjTKvom6zA.jpg" mos="https://cdn.mos.cms.futurecdn.net/CTbznnBCQPJsyjTKvom6zA.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="june-2020-netflix-premieres-2">June 2020 Netflix Premieres</h2><p><strong><strong>Wednesday, July 1</strong></strong></p><p><strong>SAY I DO</strong></p><p><strong>UNSOLVED MYSTERIES</strong></p><p><strong>Chico Bon Bon: Monkey with a Tool Belt</strong> Season 2</p><p><strong>Deadwind</strong> Season 2</p><p><strong><strong>Thursday, July 2</strong></strong></p><p><strong>WARRIOR NUN</strong></p><p><strong>THIAGO VENTURA: POKAS</strong></p><p><strong><strong>Friday, July 3</strong></strong></p><p><a href="https://www.cinemablend.com/television/2492509/meet-netflixs-the-baby-sitters-club-cast" data-original-url="https://www.cinemablend.com/television/2492509/meet-netflixs-the-baby-sitters-club-cast"><strong>THE BABY-SITTERS CLUB</strong></a></p><p><strong>JU-ON: ORIGINS</strong></p><p><strong>SOUTHERN SURVIVAL</strong></p><p><strong>Cable Girls</strong> Season 5 Part 2</p><p><strong><strong>Wednesday, July 8</strong></strong></p><p><strong>STATELESS</strong></p><p><strong>WAS IT LOVE?</strong></p><p><strong><strong>Thursday, July 9</strong></strong></p><p><strong>JAPAN SINKS: 2020</strong></p><p><strong>THE PROTECTOR</strong></p><p><strong><strong>Friday, July 10</strong></strong></p><p><strong>DOWN TO EARTH WITH ZAC EFRON</strong></p><p><strong>THE TWELVE</strong></p><p><strong>The Epic Tales of Captain Underpants in Space</strong> Season 4</p><p><strong>Hello Ninja</strong> Season 3</p><p><strong><strong>Tuesday, July 14</strong></strong></p><p><strong>URZILA CARLSON: OVERQUALIFIED LOSER</strong></p><p><strong><strong>Wednesday, July 15</strong></strong></p><p><strong>DARK DESIRE</strong></p><p><strong>SKIN DECISION: BEFORE AND AFTER</strong></p><p><strong><strong>Thursday, July 16</strong></strong></p><p><strong>INDIAN MATCHMAKING</strong></p><p><strong><strong>Friday, July 17</strong></strong></p><p><strong>CURSED</strong></p><p><strong><strong>Monday, July 20</strong></strong></p><p><strong>The Expanding Universe of Ashley Garcia</strong> Part 2</p><p><strong><strong>Tuesday, July 21</strong></strong></p><p><strong>JACK WHITEHALL: I'M ONLY JOKING</strong></p><p><strong>STREET FOOD: LATIN AMERICA</strong></p><p><strong>How to Sell Drugs Online</strong> Season 2</p><p><strong><strong>Wednesday, July 22</strong></strong></p><p><strong>SIGNS</strong></p><p><strong>FEAR CITY: NEW YORK VS THE MAFIA</strong></p><p><strong>LOVE ON THE SPECTRUM</strong></p><p><strong>Norsemen</strong> Season 3</p><p><strong><strong>Friday, July 24</strong></strong></p><p><strong>DRAGONS: RESCUE RIDERS: SECRETS OF THE SONGWING</strong></p><p><strong><strong>Tuesday, July 28</strong></strong></p><p><strong>LAST CHANCE U: LANEY</strong></p><p><strong><strong>Wednesday, July 29</strong></strong></p><p><strong>Inside the World's Toughest Prisons</strong> Season 4</p><p><strong><strong>Thursday, July 30</strong></strong></p><p><strong>TRANSFORMERS: WAR FOR CYBERTRON TRILOGY</strong></p><p><strong><strong>Friday, July 31</strong></strong></p><p><strong>GET EVEN</strong></p><p><strong>LATTE AND THE MAGIC WATERSTONE</strong></p><p><strong>Sugar Rush: Extra Sweet</strong> Season 3</p><p><a href="https://www.cinemablend.com/television/2494644/the-umbrella-academy-star-reveals-the-amusing-way-the-show-is-wrapping-season-2-in-quarantine" data-original-url="https://www.cinemablend.com/television/2494644/the-umbrella-academy-star-reveals-the-amusing-way-the-show-is-wrapping-season-2-in-quarantine"><strong>The Umbrella Academy</strong> Season 2</a></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="ZeiqZ5FWCynadEDN7WsUAh" name="" alt="lucifer smiling season 4" src="https://cdn.mos.cms.futurecdn.net/ZeiqZ5FWCynadEDN7WsUAh.jpg" mos="https://cdn.mos.cms.futurecdn.net/ZeiqZ5FWCynadEDN7WsUAh.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="august-2020-netflix-premieres">August 2020 Netflix Premieres</h2><p><strong><strong>Saturday, August 1</strong></strong></p><p><strong>SUPER MONSTERS: THE NEW CLASS</strong></p><p><strong><strong>Sunday, August 2</strong></strong></p><p><strong>CONNECTED</strong></p><p><strong><strong>Monday, August 3</strong></strong></p><p><strong>IMMIGRATION NATION</strong></p><p><strong><strong>Tuesday, August 4</strong></strong></p><p><strong>A GO! GO! CORY CARSON SUMMER CAMP</strong> (Special)</p><p><strong>MYSTERY LAB</strong></p><p><strong>SAM JAY: 3 IN THE MORNING</strong></p><p><strong><strong>Wednesday, August 5</strong></strong></p><p><strong>WORLD'S MOST WANTED</strong></p><p><strong><strong>Thursday, August 6</strong></strong></p><p><strong>The Rain</strong> Season 3</p><p><strong>THE SEVEN DEADLY SINS: IMPERIAL WRATH OF THE GODS</strong></p><p><strong><strong>Friday, August 7</strong></strong></p><p><strong>High Seas</strong> Season 2</p><p><strong>The Magic School Bus Rides Again</strong> Season 3</p><p><strong>Nailed It Mexico</strong> Season 2</p><p><strong>The New Legends of Monkey</strong> Season 2</p><p><strong>Selling Sunset</strong> Season 3</p><p><strong>SING ON! GERMANY</strong></p><p><strong>TINY CREATURES</strong></p><p><strong>WIZARDS: TALES OF ARCADIA</strong></p><p><strong>WORD PARTY SONGS</strong></p><p><strong><strong>Monday, August 10</strong></strong></p><p><strong>GAME ON: A COMEDY CROSSOVER EVENT</strong></p><p><strong><strong>Tuesday, August 11</strong></strong></p><p><strong>ROB SCHNEIDER: ASIAN MOMMA< MEXICAN KIDS</strong></p><p><strong><strong>Wednesday, August 12</strong></strong></p><p><strong>(UN)WELL</strong></p><p><strong><strong>Friday, August 14</strong></strong></p><p><strong>3%</strong> Season 4</p><p><strong>THE GREAT HEIST</strong></p><p><strong>Glow Up</strong> Season 2</p><p><strong>OCTONAUTS & THE CAVES OF SAC ACTUN</strong> (Special)</p><p><strong>TEENAGE BOUNTY HUNTERS</strong></p><p><strong><strong>Saturday, August 15</strong></strong></p><p><strong>Rita</strong> Season 5</p><p><strong>Stranger</strong> Season 2</p><p><strong><strong>Monday, August 17</strong></strong></p><p><strong>Glitch Techs</strong> Season 2</p><p><strong><strong>Wednesday, August 19</strong></strong></p><p><strong>DEMARCUS FAMILY RULES</strong></p><p><strong>HIGH SCORE</strong></p><p><strong><strong>Thursday, August 20</strong></strong></p><p><strong>BIOHACKERS</strong></p><p><strong>GREAT PRETENDER</strong></p><p><strong><strong>Friday, August 21</strong></strong></p><p><strong>ALIEN TV</strong></p><p><strong>HOOPS</strong></p><p><strong>Lucifer</strong> Season 5</p><p><strong>Rust Valley Restorers</strong> Season 3</p><p><strong><strong>Tuesday, August 25</strong></strong></p><p><strong>EMILY'S WONDER LAB</strong></p><p><strong>Trinkets</strong> Season 2</p><p><strong><strong>Wednesday, August 26</strong></strong></p><p><strong>MILLION DOLLAR BEACH HOUSE</strong></p><p><strong><strong>Thursday, August 27</strong></strong></p><p><strong>Aggretsuko</strong> Season 3</p><p><strong><strong>Friday, August 28</strong></strong></p><p><strong>Cobra Kai</strong> Seasons 1-2 (Now a Netflix Original)</p><p><strong>I AM A KILLER: RELEASED</strong></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="zb3xm3joMQk7gSEXfL6JVU" name="" alt="ratched sarah paulson netflix" src="https://cdn.mos.cms.futurecdn.net/zb3xm3joMQk7gSEXfL6JVU.jpg" mos="https://cdn.mos.cms.futurecdn.net/zb3xm3joMQk7gSEXfL6JVU.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: netflix press)</span></figcaption></figure><h2 id="september-2020-netflix-premieres">September 2020 Netflix Premieres</h2><p><strong><strong>Tuesday, September 1</strong></strong></p><p><strong>BOOKMARKS</strong></p><p><strong>The Boss Baby: Get That Baby! Interactive Special</strong></p><p><strong>FELIPE ESPARZA: BAD DECISIONS</strong></p><p><strong>True: Friendship Day</strong> Special</p><p><strong><strong>Wednesday, September 2</strong></strong></p><p><strong>CHEF'S TABLE: BBQ</strong></p><p><strong>BAD BOY BILLIONAIRES</strong></p><p><strong><strong>Thursday, September 3</strong></strong></p><p><strong>YOUNG WALLANDER</strong></p><p><strong><strong>Friday, September 4</strong></strong></p><p><strong>AWAY</strong></p><p><strong>Spirit Riding Free: Riding Academy</strong> Season 2</p><p><strong><strong>Sunday, September 6</strong></strong></p><p><strong>Undercover</strong> Season 2</p><p><strong><strong>Tuesday, September 8</strong></strong></p><p><strong>Starbeam</strong> Season 2</p><p><strong><strong>Wednesday, September 9</strong></strong></p><p><strong>GET ORGANIZED WITH THE HOME EDIT</strong></p><p><strong>LA LÍNEA: SHADOW OF NARCO</strong></p><p><strong><strong>Thursday, September 10</strong></strong></p><p><strong>JULIE AND THE PHANTOMS</strong></p><p><strong>THE IDHUN CHRONICLES</strong></p><p><strong>The Gift</strong> Season 2</p><p><strong><strong>Friday, September 11</strong></strong></p><p><strong>THE DUCHESS</strong></p><p><strong>POKÉMON JOURNEYS</strong> Season 23 Fall Premiere</p><p><strong>Family Business</strong> Season 2</p><p><strong><strong>Tuesday, September 15</strong></strong></p><p><strong>Taco Chronicles</strong> Season 2</p><p><strong>IZZY'S KOALA WORLD</strong></p><p><strong><strong>Wednesday, September 16</strong></strong></p><p><strong>Criminal: UK</strong> Season 2</p><p><strong>Maneater</strong> Season 9</p><p><strong>Baby</strong> Season 3</p><p><strong>SING ON!</strong></p><p><strong>CHALLENGER</strong></p><p><strong><strong>Thursday, September 17</strong></strong></p><p><strong>DRAGON'S DOGMA</strong></p><p><strong>THE LAST WORD</strong></p><p><strong><strong>Friday, September 18</strong></strong></p><p><strong>JURASSIC WORLD: CAMP CRETACEOUS</strong></p><p><strong>RATCHED</strong></p><p><strong>AMERICAN BARBECUE SHOWDOWN</strong></p><p><strong><strong>Tuesday, September 22</strong></strong></p><p><strong>Jack Whitehall: Travels with My Father</strong> Season 4</p><p><strong>Chico Bon Bon: Monkey with a Tool Belt</strong> Season 3</p><p><strong>MIGHTY EXPRESS</strong></p><p><strong><strong>Thursday, September 24</strong></strong></p><p><strong>The Chef Show</strong> Season 2</p><p><strong><strong>Friday, September 25</strong></strong></p><p><strong>THE SCHOOL NURSE FILES</strong></p><p><strong>SNEAKERHEADS</strong></p><p><strong>COUNTRY-ISH</strong></p><p><strong><strong>Monday, September 28</strong></strong></p><p><strong>WHOSE VOTE COUNTS, EXPLAINED</strong></p><p><strong><strong>Tuesday, September 29</strong></strong></p><p><strong>MICHELLE BUTEAU: WELCOME TO BUTEAUPIA</strong></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="DdGZ4YKzQwYxTWudh6MeRT" name="" alt="haunting of bly manor" src="https://cdn.mos.cms.futurecdn.net/DdGZ4YKzQwYxTWudh6MeRT.jpg" mos="https://cdn.mos.cms.futurecdn.net/DdGZ4YKzQwYxTWudh6MeRT.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: netflix press)</span></figcaption></figure><h2 id="october-2020-netflix-premieres">October 2020 Netflix Premieres</h2><p><strong><strong>Thursday, October 1</strong></strong></p><p><strong>Carmen Sandiego</strong> Season 3</p><p><strong>The Worst Witch</strong> Season 4</p><p><strong>OKTOBERFEST: BEER & BLOOD</strong></p><p><strong>GOOD MORNING, VERÔNICA</strong></p><p><strong><strong>Friday, October 2</strong></strong></p><p><strong>A Go! Go! Cory Carson Halloween</strong></p><p><strong>EMILY IN PARIS</strong></p><p><strong>SONG EXPLODER</strong></p><p><strong><strong>Tuesday, October 6</strong></strong></p><p><strong>Starbeam: Halloween Hero</strong></p><p><strong><strong>Wednesday, October 7</strong></strong></p><p><strong>TO THE LAKE</strong></p><p><strong><strong>Friday, October 9</strong></strong></p><p><strong>The Haunting of Bly Manor</strong> Season 2</p><p><strong>Fast & Furious Spy Racers: Rio</strong> Season 2</p><p><strong>Super Monsters: Dia de los Monsters</strong></p><p><strong>DEAF U</strong></p><p><strong><strong>Monday, October 12</strong></strong></p><p><strong>Kipo and the Age of Wonderbeasts</strong> Season 3</p><p><strong><strong>Tuesday, October 13</strong></strong></p><p><strong>THE CABIN WITH BERT KREISCHER</strong></p><p><strong><strong>Thursday, October 15</strong></strong></p><p><strong>SOCIAL DISTANCE</strong></p><p><strong><strong>Friday, October 16</strong></strong></p><p><strong>The Last Kids On Earth</strong> Book 3</p><p><strong>GRAND ARMY</strong></p><p><strong>DREAM HOME MAKEOVER</strong></p><p><strong>LA RÉVOLUTION</strong></p><p><strong>SOMEONE HAS TO DIE</strong></p><p><strong><strong>Monday, October 19</strong></strong></p><p><strong>Unsolved Mysteries</strong> Season 2</p><p><strong><strong>Tuesday, October 20</strong></strong></p><p><strong>The Magic School Bus Rides Again: The Frizz Connection</strong></p><p><strong><strong>Wednesday, October 21</strong></strong></p><p><strong>My Next Guest Needs No Introduction with David Letterman</strong></p><p><strong><strong>Friday, October 23</strong></strong></p><p><strong>THE QUEEN'S GAMBIT</strong></p><p><strong>MOVE</strong></p><p><strong>BARBARIANS</strong></p><p><strong>PERDIDA</strong></p><p><strong><strong>Tuesday, October 27</strong></strong></p><p><strong>Chico Bon Bon: Monkey with a Tool Belt</strong> Season 4</p><p><strong>BLOOD OF ZEUS</strong></p><p><strong><strong>Friday, October 30</strong></strong></p><p><strong>Somebody Feed Phil</strong> Season 4</p><p><strong>Suburra</strong> Season 3</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="5VY3dkU44AL89RfkYzUNUD" name="" alt="kingdom netflix" src="https://cdn.mos.cms.futurecdn.net/5VY3dkU44AL89RfkYzUNUD.jpg" mos="https://cdn.mos.cms.futurecdn.net/5VY3dkU44AL89RfkYzUNUD.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="november-2020-netflix-premieres">November 2020 Netflix Premieres</h2><p><strong><strong>Sunday, November 1</strong></strong></p><p><strong>Can You Hear Me?</strong> Season 2</p><p><strong><strong>Tuesday, November 3</strong></strong></p><p><strong>FELIX LOBRECHT: HYPE</strong></p><p><strong><strong>Wednesday, November 4</strong></strong></p><p><strong>LOVE AND ANARCHY</strong></p><p><strong><strong>Thursday, November 5</strong></strong></p><p><strong>CARMEL: WHO KILLED MARIA MARTA?</strong></p><p><strong>PARANORMAL</strong></p><p><strong><strong>Friday, November 6</strong></strong></p><p><strong>COUNTRY EVER AFTER</strong></p><p><strong><strong>Monday, November 9</strong></strong></p><p><strong>Undercover</strong> Season 2</p><p><strong><strong>Tuesday, November 10</strong></strong></p><p><strong>DASH & LILY</strong></p><p><strong>TRASH TRUCK</strong></p><p><strong><strong>Wednesday, November 11</strong></strong></p><p><strong>AUNTY DONNA'S BIG OL' HOUSE OF FUN</strong></p><p><strong>THE LIBERATOR</strong></p><p><strong>A QUEEN IS BORN</strong></p><p><strong><strong>Friday, November 13</strong></strong></p><p><strong>THE MINIONS OF MIDAS</strong></p><p><strong><strong>Sunday, November 15</strong></strong></p><p><strong>The Crown</strong> Season 4</p><p><strong><strong>Tuesday, November 17</strong></strong></p><p><strong>The Boss Baby: Back In Business</strong> Season 4</p><p><strong>WE ARE THE CHAMPIONS</strong></p><p><strong><strong>Wednesday, November 18</strong></strong></p><p><strong>HOLIDAY HOME MAKEOVER WITH MR. CHRISTMAS</strong></p><p><strong><strong>Friday, November 20</strong></strong></p><p><strong>Flavorful Origins: Gansu Cuisine</strong> Season 3</p><p><strong>VOICES OF FIRE</strong></p><p><strong><strong>Tuesday, November 24</strong></strong></p><p><strong>Dragons: Rescue Riders – Huttsgalor Holiday Special</strong></p><p><strong>WONDEROOS</strong></p><p><strong><strong>Wednesday, November 25</strong></strong></p><p><strong>Great Pretender</strong> Season 2</p><p><strong><strong>Friday, November 27</strong></strong></p><p><strong>A Go! Go! Cory Carson Christmas</strong></p><p><strong>Sugar Ruse Christmas</strong> Season 2</p><p><strong>OVER CHRISTMAS</strong></p><p><strong>Virgin River</strong> Season 2</p><p><strong><strong>Saturday, November 28</strong></strong></p><p><strong>THE UNCANNY COUNTER</strong></p><p><strong><strong>Sunday, November 29</strong></strong></p><p><strong>Wonderoos: Holiday Holiday!</strong></p><p><strong><strong>Monday, November 30</strong></strong></p><p><strong>A LOVE SO BEAUTIFUL</strong></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="5mb2uTvtcKAWaNQrLyfz2n" name="" alt="chilling adventures of sabrina" src="https://cdn.mos.cms.futurecdn.net/5mb2uTvtcKAWaNQrLyfz2n.jpg" mos="https://cdn.mos.cms.futurecdn.net/5mb2uTvtcKAWaNQrLyfz2n.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: netflix press)</span></figcaption></figure><h2 id="december-2020-netflix-premieres">December 2020 Netflix Premieres</h2><p><strong><strong>Tuesday, December 1</strong></strong></p><p><strong>THE HOLIDAY MOVIES THAT MADE US</strong></p><p><strong>NATALIE PALAMIDES: NATE – A ONE MAN SHOW</strong></p><p><strong><strong>Wednesday, December 2</strong></strong></p><p><strong>ALIEN WORLDS</strong></p><p><strong>ARI ELDJÁRN: PARDON MY ICELANDIC</strong></p><p><strong>HAZEL BRUGGER: TOPICAL</strong></p><p><strong><strong>Thursday, December 3</strong></strong></p><p><strong>CHICO BON BON AND THE VERY BERRY HOLIDAY</strong></p><p><strong><strong>Friday, December 4</strong></strong></p><p><strong>BHAAG BEANIE BHAAG</strong></p><p><strong>Big Mouth</strong> Season 4</p><p><strong>CAPTAIN UNDERPANTS MEGA BLISSMAS</strong></p><p><strong>The Great British Baking Show: Holidays</strong> Season 3</p><p><strong>Pokémon Journeys: The Series</strong> Season 3</p><p><strong>SELENA: THE SERIES</strong></p><p><strong><strong>Saturday, December 5</strong></strong></p><p><strong>DETENTION</strong></p><p><strong>MIGHTY EXPRESS: A MIGHTY CHRISTMAS</strong></p><p><strong><strong>Tuesday, December 8</strong></strong></p><p><strong>LOVESTRUCK IN THE CITY</strong></p><p><strong>Mr. Iglesias</strong> Season 3</p><p><strong>SPIRIT RIDING FREE: RIDE ALONG ADVENTURE</strong></p><p><strong>SUPER MONSTERS: SANTA'S SUPER MONSTER HELPERS</strong></p><p><strong><strong>Wednesday, December 9</strong></strong></p><p><strong>ASHLEY GARCIA: GENIUS IN LOVE: CHRISTMAS</strong></p><p><strong>THE BIG SHOW SHOW: CHRISTMAS</strong></p><p><strong>THE SURGEON'S CUT</strong></p><p><strong><strong>Thursday, December 10</strong></strong></p><p><strong>ALICE IN BORDERLAND</strong></p><p><strong><strong>Friday, December 11</strong></strong></p><p><strong>A TRASH TRUCK CHRISTMAS</strong></p><p><strong>THE MESS YOU LEAVE BEHIND</strong></p><p><strong><strong>Monday, December 14</strong></strong></p><p><strong>Hilda</strong> Season 2</p><p><strong>TINY PRETTY THINGS</strong></p><p><strong><strong>Tuesday, December 15</strong></strong></p><p><strong>Song Exploder</strong> Season 2</p><p><strong><strong>Wednesday, December 16</strong></strong></p><p><strong>HOW TO RUIN CHRISTMAS: THE WEDDING</strong></p><p><strong>RUN ON</strong></p><p><strong>VIR DAS: OUTSIDE IN – THE LOCKDOWN SPECIAL</strong></p><p><strong><strong>Friday, December 18</strong></strong></p><p><strong>Home for Christmas</strong> Season 2</p><p><strong>SWEET HOME</strong></p><p><strong><strong>Tuesday, December 22</strong></strong></p><p><strong>LONDON HUGHES: TO CATCH A D*CK</strong></p><p><strong>RHYME TIME TOWN SINGALONGS</strong></p><p><strong><strong>Friday, December 25</strong></strong></p><p><strong>BRIDGERTON</strong></p><p><strong><strong>Saturday, December 26</strong></strong></p><p><strong>Fast & Furious Spy Racers</strong> Season 3</p><p><strong>Go! Go! Cory Carson</strong> Season 3</p><p><strong>THE MAGIC SCHOOL BUS RIDES AGAIN IN THE ZONE</strong></p><p><strong><strong>Wednesday, December 30</strong></strong></p><p><strong>BEST LEFTOVERS EVER!</strong></p><p><strong>EQUINOX</strong></p><p><strong>Transformers: War for Cybertron Trilogy</strong> Season 2</p><p><strong><strong>Thursday, December 31</strong></strong></p><p><strong>BEST OF STAND-UP 2020</strong></p><p><strong>Chilling Adventures of Sabrina</strong> Season 4</p><h2 id="more-2020-netflix-premieres-yet-to-be-announced">More 2020 Netflix Premieres Yet To Be Announced</h2><p>Understandably, Netflix has a ton of projects that are either still unable to go back into production, or are on their way to begin filming again. As such, the streaming service has yet to provide official release dates for many of the shows that we already know are getting new seasons. Netflix has, by and large, kept premiere dates close to its vest, so expect for that to remain the case in 2020.</p><p>BEHIND HER EYES</p><p>Big Mouth Season 4</p><p>Black Summer Season 2 (Possibly)</p><p>Dear White People Season 4 (Final Season)</p><p>Disenchantment Season 3</p><p>Family Reunion Season 2</p><p>I Think You Should Leave with Tim Robinson Season 2</p><p>Love, Death, & Robots Season 2</p><p>Mr. Iglesias Season 2</p><p>PACIFIC RIM</p><p>Ultraman Season 2</p><p>Stay tuned for more updates on not only better ideas of when the above shows will be popping up on Netflix, but also to see what other projects will be added to the streaming service throughout the new year. Please do bookmark this page and return every so often to see what new goodness has been announced.</p><p>For now, this is everything that Netflix currently has on the docket, but you can be sure that in the months to come, the streaming service will go public with news of many more premiere dates to come. For those wondering about all the other new and returning shows coming to TV that aren't just relegated to streaming on Netflix, check out our <a href="https://www.cinemablend.com/television/2549136/2020-fall-tv-premiere-schedule-list-of-new-and-returning-shows" data-original-url="https://www.cinemablend.com/television/2549136/2020-fall-tv-premiere-schedule-list-of-new-and-returning-shows">Fall 2020 premiere schedule</a>.</p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ 10 All-Time Great TV Show Episodes Written By Women ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/2550532/all-time-great-tv-show-episodes-written-by-women</link>
                                                                            <description>
                            <![CDATA[ Journey through these iconic moments in TV when women were behind its words. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">ceM9pkFiaXxDC3vCVC2fAc</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/XTuZpNKkcbrLhm2VkW7wC7-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Mon, 20 Jul 2020 12:00:00 +0000</pubDate>                                                                                                                                <updated>Mon, 20 Jul 2020 14:11:47 +0000</updated>
                                                                                                                                            <category><![CDATA[Television]]></category>
                                                                                                                    <dc:creator><![CDATA[ Sarah El-Mahmoud ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/eDWWFRifXaAj9sBqqk4J59.png ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Sarah El-Mahmoud has been with CinemaBlend since 2018, starting as a freelancer shortly after graduating from Cal State Fullerton with a degree in Journalism. In college, she was the Managing Editor of the award-winning college paper, The Daily Titan where she specialized in writing/editing long-form features, profiles and arts &amp;amp; entertainment coverage, including her first run-in with movie reporting, with a phone interview with Guillermo del Toro for Best Picture winner, The Shape of Water.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What She&#039;s Into&lt;/strong&gt;: Sarah is CinemaBlend&#039;s resident YA enthusiast, often bringing her lifetime love of books and the stories behind their often contentious adaptations to the site. Deeply into when music and movies intersect, from knowing the hype musical tracks of Mamma Mia!, beautiful scores of Michael Giacchino and yes, the absolute banger Twilight soundtrack way too well. She is also passionate about highlighting and interviewing voices within the industry to help open the door for Hollywood to better represent the world through movies and television. Horror, she really loves horror movies. The world of animation as well... OK don&#039;t make her pick one genre.&amp;nbsp;&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What She&#039;s Excited About Right Now&lt;/strong&gt;: The continued resurgence of horror and musicals. The next Hunger Games movie, Mike Flanagan&#039;s upcoming shows, the Wicked movies and the final Spider-Verse animated film.&amp;nbsp;&lt;/p&gt; ]]></dc:description>
                                                                                                                                <cf:isSponsored>false</cf:isSponsored>
                <cf:hasAffiliateLinks>false</cf:hasAffiliateLinks>
                <cf:isPaid>false</cf:isPaid>
                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/XTuZpNKkcbrLhm2VkW7wC7-1280-80.jpg">
                                                            <media:credit><![CDATA[(BBC)]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[Phoebe Waller-Bridge in Fleabag]]></media:description>                                                            <media:text><![CDATA[Phoebe Waller-Bridge in Fleabag]]></media:text>
                                <media:title type="plain"><![CDATA[Phoebe Waller-Bridge in Fleabag]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/XTuZpNKkcbrLhm2VkW7wC7-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>Television can be redundant. Showrunners get into this cycle of what works and say there such as with the tried-and-true family comedy, cop drama or high school soap. But with the turn of the century, TV gave way to a new golden age to the medium. One mix-up that has contributed greatly to the progress of television is having more female showrunners and writers among the male-dominated industry. Even <a href="https://www.cinemablend.com/television/2549935/why-do-so-many-people-dislike-doctor-whos-female-doctor" data-original-url="https://www.cinemablend.com/television/2549935/why-do-so-many-people-dislike-doctor-whos-female-doctor">though female characters are much more common</a> today, women’s words only account for about 30 percent of what you see on your small screens.</p><p>In celebration of these exciting strides for representation, let’s look at some all-time great television episodes penned by women:</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="fbptG2QBnEzDnxBkdgZywk" name="" alt="Ellen DeGeneres and Laura Dern in The Puppy Episode" src="https://cdn.mos.cms.futurecdn.net/fbptG2QBnEzDnxBkdgZywk.jpg" mos="https://cdn.mos.cms.futurecdn.net/fbptG2QBnEzDnxBkdgZywk.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: (ABC))</span></figcaption></figure><h2 id="ellen-degeneres-ellen-the-puppy-episode">Ellen DeGeneres - Ellen, “The Puppy Episode”</h2><p>Ellen DeGeneres has undoubtedly become one of the most well-known names in television with her highly-popular talk show and philanthropy. Before she booked <em>The Ellen Show</em>, the comedian was given the opportunity to front her own sitcom simply called <em>Ellen</em> in the ‘90s. The only episode she wrote the story for herself is an immensely defining moment in television. 1997’s “The Puppy Episode” had Ellen’s television alter-ego come out as gay to Laura Dern’s Susan and a therapist played by Oprah Winfrey. The episode created a huge stir in the industry, causing threats from advertisers and religious groups, but has since become a cultural moment TV won’t forget.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="G3VsowtASXfGaqZjgRZen9" name="" alt="Allison Williams and Christopher Abbott in Girls" src="https://cdn.mos.cms.futurecdn.net/G3VsowtASXfGaqZjgRZen9.jpg" mos="https://cdn.mos.cms.futurecdn.net/G3VsowtASXfGaqZjgRZen9.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: (HBO))</span></figcaption></figure><h2 id="lena-dunham-girls-the-panic-in-central-park">Lena Dunham - Girls, “The Panic In Central Park”</h2><p>A staple in female-run television in the modern age was HBO’s <em>Girls</em>, created by <a href="https://www.cinemablend.com/news/2548470/how-lena-dunham-influenced-the-king-of-staten-island" data-original-url="https://www.cinemablend.com/news/2548470/how-lena-dunham-influenced-the-king-of-staten-island">Lena Dunham</a>. The show itself broke a lot of ground as to how women could be perceived and discussed about on television. <em>Girls</em> ran six seasons but Lena Dunham calls Season 5’s sixth episode the <a href="https://www.bustle.com/articles/150891-lena-dunham-shares-inspiration-for-the-girls-marnie-episode-in-new-clip-video">piece of writing she’s “most proud of.”</a> After Allison Williams’ Marnie was MIA for much of that season, she returned for a beautiful self-contained episode of her own. Newly married to Desi but coming off a fight with him she runs into her ex Charlie (Christopher Abbott) and the pair have an eventful night out that leads her to make an important decision.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="26JyDQfG8c34XBKVdYJ574" name="" alt="Alexis Bledel and Lauren Graham in Gilmore Girls" src="https://cdn.mos.cms.futurecdn.net/26JyDQfG8c34XBKVdYJ574.jpg" mos="https://cdn.mos.cms.futurecdn.net/26JyDQfG8c34XBKVdYJ574.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: (Warner Bros))</span></figcaption></figure><h2 id="amy-sherman-palladino-gilmore-girls-they-shoot-the-gilmores-don-t-they">Amy Sherman-Palladino - Gilmore Girls, “They Shoot The Gilmores, Don’t They?”</h2><p>What’s beautiful about Warner Bros television’s <em>Gilmore Girls</em> is there will never be anything quite like it again. Showrunner Amy Sherman-Palladino has rapid-fire quips and smart dialogue that has since found a new home on Emmy-winning Amazon series <a href="https://www.cinemablend.com/television/2549233/the-marvelous-mrs-maisels-creator-has-no-patience-for-one-complaint-about-the-show" data-original-url="https://www.cinemablend.com/television/2549233/the-marvelous-mrs-maisels-creator-has-no-patience-for-one-complaint-about-the-show"><em>The Marvelous Mrs. Maisel</em></a>. But <em>Gilmore Girls</em> – if you lead, we will follow. Looking back, sure there’s some flaws to take in about Rory Gilmore specifically, but this Season 3 episode that aired in 2002 is a reminder of the show’s high point. Between boy drama with Rory and Lorelai and Stars Hollow town fun in the form of a 24-hour dance marathon it's the perfect episode to look back on.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="8Jg6pRqmkThx6mbuWeYpeD" name="" alt="Buffy the Vampire Slayer, “Conversations With Dead People” episode" src="https://cdn.mos.cms.futurecdn.net/8Jg6pRqmkThx6mbuWeYpeD.jpg" mos="https://cdn.mos.cms.futurecdn.net/8Jg6pRqmkThx6mbuWeYpeD.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: (Warner Bros))</span></figcaption></figure><h2 id="jane-espenson-buffy-the-vampire-slayer-conversations-with-dead-people">Jane Espenson - Buffy the Vampire Slayer, “Conversations With Dead People”</h2><p>Wow did it take a while for women to have a lead role in the action/fantasy genre, but we can thank Buffy the Vampire Slayer for proving there’s a massive audience for a genre title starring a badass woman. The iconic series was created by Joss Whedon, but one prominent writer on the show was Jane Espenson, who has gone on to write for ABC’s <em>Once Upon a Time</em> and Netflix’s <em>Jessica Jones</em>. This Season 7 episode (also from 2002) turned the series into a horror movie for a minute as each main character in the series encounters a member of the dead with great depth.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="VLNQtvWjkTPeNuYp4S4esS" name="" alt="Ellen Pompeo, Christina Ricci and Sandra Oh in Grey's Anatomy season 2 finale" src="https://cdn.mos.cms.futurecdn.net/VLNQtvWjkTPeNuYp4S4esS.jpg" mos="https://cdn.mos.cms.futurecdn.net/VLNQtvWjkTPeNuYp4S4esS.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: (ABC))</span></figcaption></figure><h2 id="shonda-rhimes-grey-s-anatomy-it-s-the-end-of-the-world-as-we-know-it">Shonda Rhimes - Grey’s Anatomy, “It’s The End of the World/As We Know It”</h2><p>Shondaland! One cannot even begin to express the importance Shonda Rhimes has on television’s shift to the more diverse place it is today. There’s a reason <em>Grey’s Anatomy</em> has remained popular past 16 seasons, audiences are not ready to let go of these characters. The medical drama has changed immensely over the years as Rhimes pursued more shows including <em>Scandal</em> and <em>Private Practice</em>, but let’s look back on 2006’s two-part Season 2 finale. “It’s The End of the World/As We Know It” is one heck of a thriller centering on a patient who enters the OR with a bomb lodged in his chest.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="cQDLKtxwRpJWGJHSafRyd6" name="" alt="Samira Wiley in Orange is the new Black Toast Can’t Never Bread Again episode" src="https://cdn.mos.cms.futurecdn.net/cQDLKtxwRpJWGJHSafRyd6.jpg" mos="https://cdn.mos.cms.futurecdn.net/cQDLKtxwRpJWGJHSafRyd6.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: (Netflix))</span></figcaption></figure><h2 id="tara-herrmann-and-jenji-kohan-orange-is-the-new-black-toast-can-t-never-bread-again">Tara Herrmann and Jenji Kohan - Orange Is the New Black, “Toast Can’t Never Bread Again”</h2><p>The landscape of television found itself a shake-up when Netflix began developing original programming starting with <em>House of Cards</em> and <em>Orange is the New Black</em>. The Jenji Kohan created series about a women’s prison presented storylines about a spectrum of identities in an entertaining and relentless way for its seven seasons on the streaming service. In this 2016 Season 4 finale, Jenji Kohan and co-writer Tara Herrmann delivered an unexpected delight. After the death of fan-favorite Poussey by prison guards in the episode before, “Toast Can’t Never Bread Again” combats the anger of the event by taking audiences on a series of flashbacks with Poussey.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="EFm6RDLeo82FmckL5XnPwX" name="" alt="Phoebe Waller-Bridge in Fleabag season 2" src="https://cdn.mos.cms.futurecdn.net/EFm6RDLeo82FmckL5XnPwX.jpg" mos="https://cdn.mos.cms.futurecdn.net/EFm6RDLeo82FmckL5XnPwX.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: (BBC))</span></figcaption></figure><h2 id="phoebe-waller-bridge-fleabag-season-2-episode-1">Phoebe Waller-Bridge - Fleabag, “Season 2, Episode 1”</h2><p>Phoebe Waller-Bridge has to be the highest-profile female writer working right now to create a more interesting place for television in Britain specifically. She recently <a href="https://www.cinemablend.com/news/2490434/no-time-to-dies-ana-de-armas-explains-why-she-was-unsure-about-the-role" data-original-url="https://www.cinemablend.com/news/2490434/no-time-to-dies-ana-de-armas-explains-why-she-was-unsure-about-the-role">worked on the script for <em>No Time To Die</em> to redefine the Bond Girl</a> and developed <em>Killing Eve</em> for television, but it's <em>Fleabag</em> that shows off all her chops. The Amazon Original took home a stunning six Emmys last year, with eyes fixed on the Season 2 premiere. The episode about an uncomfortable dinner is cringey and hilarious while also somehow being a beautiful illustration of guilt and loneliness in the presence of others.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="aYYfujzCoYFUDiqXoe3A7F" name="" alt="Bojack Horseman, Face of Depression episode" src="https://cdn.mos.cms.futurecdn.net/aYYfujzCoYFUDiqXoe3A7F.png" mos="https://cdn.mos.cms.futurecdn.net/aYYfujzCoYFUDiqXoe3A7F.png" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: (Netflix))</span></figcaption></figure><h2 id="shauna-mcgarry-bojack-horseman-the-face-of-depression">Shauna McGarry - Bojack Horseman, “The Face of Depression”</h2><p>Another staple for Netflix’s success in television has been the adult-animation existential-crisis comedy <em>Bojack Horseman</em>. The show created by Raphael Bob-Waksberg often examines fame and ego in today’s world through has-been Bojack, played by Will Arnett. The series ended this year after six seasons. In 2019’s “Face of Depression,” Shauna McGarry wrote maybe the most peaceful episode of <em>Bojack Horseman</em> that brings about hope in the characters in a way that the show rarely leaves audiences with as the horse travels cross country to reconnect with loved ones. McGarry has only written two episodes of <em>Bojack</em> and the most important episode of <em>Tuca & Bertie</em> along with a handful for <em>Anger Management</em> and <em>Take My Wife</em>. She’s one to watch.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="rYh8shFNt2Af6Qejt9a3xh" name="" alt="Reese Witherspoon and Jennifer Aniston in The Morning Show" src="https://cdn.mos.cms.futurecdn.net/rYh8shFNt2Af6Qejt9a3xh.jpg" mos="https://cdn.mos.cms.futurecdn.net/rYh8shFNt2Af6Qejt9a3xh.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: (Apple))</span></figcaption></figure><h2 id="kerry-ehrin-the-morning-show-the-interview">Kerry Ehrin - The Morning Show, “The Interview”</h2><p>Another recent addition to television written by a female voice is AppleTV+’s debut drama <em>The Morning Show</em> which is sure to rack up awards this season. The show has a lot of female talent on board – its produced by its stars Reese Witherspoon and Jennifer Aniston and written by Kerry Ehrin and Jay Carson. Ehrin has quietly been a massive voice on television with credits on <em>Friday Night Lights</em>, <em>Parenthood</em> and <em>Bates Motel</em> before <em>The Morning Show</em>. The 2019 season one finale of the drama titled “The Interview” that wraps up its season long conversation about sexual harassment and the media in a shocking way.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="hzAnFW5WVvRAByssYveDeT" name="" alt="Bryan Cranston and Aaron Paul in Breaking Bad" src="https://cdn.mos.cms.futurecdn.net/hzAnFW5WVvRAByssYveDeT.jpg" mos="https://cdn.mos.cms.futurecdn.net/hzAnFW5WVvRAByssYveDeT.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: (AMC))</span></figcaption></figure><h2 id="moira-walley-beckett-breaking-bad-ozymandias">Moira Walley-Beckett - Breaking Bad, “Ozymandias”</h2><p>“Ozymandias” is thought of as the best <em>Breaking Bad</em> episode of all time, which is high praise considering the show itself is often thought of as the best <em>show</em> of all time. The Season 6 antepenultimate episode was written by Moira Walley-Beckett and directed by the great Rian Johnson of <em>The Last Jedi</em> and <em>Knives Out</em>. Walley-Beckett has written eight other episodes on the series and created <em>Flesh and Bone</em> and <em>Anne with an E</em>. The title is inspired by the 1818 Percy Bysshe Shelley poem and sets up the final moments on television for Walter White.</p><p>Stay tuned here on CinemaBlend for more coverage on the best of television.</p><div  class="fancy-box"><div class="fancy_box-title">Up next: <a href="https://www.cinemablend.com/pop/2487227/fleabag-and-more-amazing-phoebe-waller-bridge-projects" data-original-url="https://www.cinemablend.com/pop/2487227/fleabag-and-more-amazing-phoebe-waller-bridge-projects"><u><strong>Fleabag And 8 More Amazing Phoebe Waller-Bridge Projects</strong></u></a></div><div class="fancy_box_body"><figure class="van-image-figure "  ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="" name="" caption="" alt="" src="https://img.cinemablend.com/quill/8/1/e/8/a/9/81e8a913a9e29532b29dd10c188a91f4454dd51d.jpg" mos="" link="" align="" fullscreen="" width="0" height="0" attribution="" endorsement="" class="pinterest-pin-exclude"></p></div></div></figure></div></div>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ 9 Issa Rae Projects To Check Out After Netflix’s The Lovebirds ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/2547735/issa-rae-projects-to-check-out-after-netflixs-the-lovebirds</link>
                                                                            <description>
                            <![CDATA[ Issa Rae really shines in The Lovebirds, but she shines even brighter in these projects. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">tPvWvyU1gvwHasgQzjniBH</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/ChBBMpga3HAFEeV73WnP4L-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Mon, 08 Jun 2020 18:11:34 +0000</pubDate>                                                                                                                                <updated>Mon, 08 Jun 2020 18:37:39 +0000</updated>
                                                                                                                                            <category><![CDATA[Movies]]></category>
                                                                                                <author><![CDATA[ jerricatisdale@gmail.com (Jerrica Tisdale) ]]></author>                    <dc:creator><![CDATA[ Jerrica Tisdale ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/mghyh8MTj3fuUnFCUCPZuQ.png ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background: &lt;/strong&gt;Jerrica Tisdale is a freelance writer at Cinemablend. She joined the team as a freelancer in 2019. She began freelance writing in 2012 (celebrating a big 10-year milestone in 2022). Over the last decade-plus, Jerrica has written for many different publications on pop culture topics, including TellTaleTV, Screenrant, Gossip and Gab, Big Brother Access, The List, Starpulse, and other entertainment sites. She&#039;s also done ghostwriting and copywriting for companies such as Groupon and Staples. If it&#039;s related to writing, Jerrica has probably done it at some point. However, her passion has always been for pop culture and entertainment topics. &amp;nbsp;She grew up with a deep-rooted passion for film and television. &amp;nbsp;One day, she&#039;ll finally be brave enough to write a script or ten thousand scripts. Jerrica considers her true talent to be researching, or as she likes to call it internet detective work.&amp;nbsp;&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What She&#039;s Into: &lt;/strong&gt;Her favorite shows include Parks and Rec, Buffy the Vampire Slayer, Big Brother, Veronica Mars, Fleabag, Barry, It&#039;s Always Sunny in Philadelphia, and British panel shows. Her favorite movies include Whiplash, Eternal Sunshine of the Spotless Mind, Ruby Sparks, Clueless, What We Do In The Shadows, Atonement, and most movies by David Fincher. Jerrica is also a major book nerd. She has a problem with buying too many books that she may never be able to read all of them, but she will surely try. Her favorite books include Dark Matter by Blake Crouch, Perfect Sound Whatever by James Acaster, anything by Oscar Wilde, Me Before You by Jojo Moyes, All the Light We Cannot See by Anthony Doer, Noughts and Crosses by Malorie Blackman, and anything by Khaled Hosseini, James Baldwin, Thomas Hardy, and Edgar Allen Poe. Jerrica is always searching for her next favorite but finds that to be a very hard search, so when she finds something she truly loves, she will never stop talking about it. You&#039;ll either hate that or love that about her.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What She&#039;s Excited About Right Now: &lt;/strong&gt;Jerrica is excited that it&#039;s fall movie season, aka Oscar bait season. She plans to invest in a discount movie pass and see as many potential Oscar winners as possible. She&#039;s also going to attend virtual (and possibly in-person) screenings at the Chicago International Film Festival this October. Jerrica is also excited to read as many scary or classic novels throughout the month of October. It is spooky season.&amp;nbsp;&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt; ]]></dc:description>
                                                                                                                                <cf:isSponsored>false</cf:isSponsored>
                <cf:hasAffiliateLinks>false</cf:hasAffiliateLinks>
                <cf:isPaid>false</cf:isPaid>
                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/ChBBMpga3HAFEeV73WnP4L-1280-80.jpg">
                                                            <media:credit><![CDATA[null]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[Issa Rae and Kumail Nanjiani in The Lovebirds]]></media:description>                                                            <media:text><![CDATA[Issa Rae and Kumail Nanjiani in The Lovebirds]]></media:text>
                                <media:title type="plain"><![CDATA[Issa Rae and Kumail Nanjiani in The Lovebirds]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/ChBBMpga3HAFEeV73WnP4L-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>Steadily, Issa Rae is becoming a Hollywood go-to actress for unique and quirky romantic movies. Rae has shown her versatility, vulnerability, sexiness, and relatability in various film and TV projects, so it’s no wonder that her star is even more on the rise. 2020 has been a great year for Issa Rae projects. She has appeared in two highly <a href="https://www.cinemablend.com/news/2487411/the-10-most-anticipated-romantic-movies-coming-to-theaters-in-2020" data-original-url="https://www.cinemablend.com/news/2487411/the-10-most-anticipated-romantic-movies-coming-to-theaters-in-2020">anticipated romantic movies of 2020,</a> the most popular one being The Lovebirds<em>.</em> She stars opposite Kumail Nanjiani in this <a href="https://www.cinemablend.com/news/2493003/kumail-nanjiani-and-issa-raes-the-lovebirds-is-heading-to-netflix" data-original-url="https://www.cinemablend.com/news/2493003/kumail-nanjiani-and-issa-raes-the-lovebirds-is-heading-to-netflix">recently Netflix-acquired</a> flick<em>. The Lovebirds</em> is a movie about a couple on the brink of breaking up, but they are forced to stay together and work together to solve a murder mystery.</p><p><em>The Lovebirds</em> is a highly enjoyable comedy that is sure to make you question whether you and your significant other could really win <em>The Amazing Race</em>. It showcases both Kumail Nanjiani and Issa Rae’s ability to keep viewers engaged, laughing, and rooting for them. For some, <em>The Lovebirds</em> is their first time being <a href="https://www.cinemablend.com/news/2546948/the-most-rewarding-and-challenging-part-of-making-the-lovebirds-according-to-kumail-nanjiani-and-issa-rae" data-original-url="https://www.cinemablend.com/news/2546948/the-most-rewarding-and-challenging-part-of-making-the-lovebirds-according-to-kumail-nanjiani-and-issa-rae">introduced to the actress</a>, but Rae has been creating, producing, and starring in TV shows and movies for nearly 10 years.</p><p>If you need a crash course on some of her best work, here are a few projects to check out.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="kuUgoLgBLK5v3x4mWKsLVG" name="" alt="Issa Rae in Insecure" src="https://cdn.mos.cms.futurecdn.net/kuUgoLgBLK5v3x4mWKsLVG.jpg" mos="https://cdn.mos.cms.futurecdn.net/kuUgoLgBLK5v3x4mWKsLVG.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="insecure">Insecure</h2><p><em>Insecure</em> is the <a href="https://www.cinemablend.com/television/1584160/7-shows-you-may-not-have-heard-of-that-you-need-to-binge-immediately" data-original-url="https://www.cinemablend.com/television/1584160/7-shows-you-may-not-have-heard-of-that-you-need-to-binge-immediately">hit HBO series</a> starring Issa Rae and Yvonne Orji. It was co-created by Rae and Larry Wilmore. The series follows Issa Dee (Issa Rae) and her friends as they try to figure out the next chapters in their lives. Each season deals with a major element of self-discovery, from the end of a relationship to the beginning of one, to new jobs to losing jobs, to babies, marriages, starting a business, and so much more.</p><p><em>Insecure</em> creates complex characters who rarely have it together. It’s about their journeys and all the ways they get it wrong-and then sometimes figure it out and get it right. The series is a hilarious look at issues faced not only by modern black women and men, but universal issues that everyone faces on the path to growing up.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="s7PoQoD3YTMBzTLyxCznka" name="" alt="Issa Rae in the Misadventures of The Awkward Black Girl" src="https://cdn.mos.cms.futurecdn.net/s7PoQoD3YTMBzTLyxCznka.jpg" mos="https://cdn.mos.cms.futurecdn.net/s7PoQoD3YTMBzTLyxCznka.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="the-misadventures-of-awkward-black-girl">The Misadventures Of Awkward Black Girl</h2><p>This <a href="https://www.youtube.com/watch?v=nIVa9lxkbus&list=PL854514FC0EBDCD8E">web-series</a> follows J (Issa Rae), an awkward 20-something black girl who tries to navigate the awkwardness of everyday situations, like mean co-workers, new relationships, and friendships. The series started in 2011, and had two seasons. Most of the episodes are under five minutes long. <em>The Misadventures of Awkward Black Girl</em> is what initially got people to take notice of Issa Rae’s comedic style and fresh voice. The series clearly helped influence some elements that she uses in <em>Insecure.</em></p><p><a href="http://www.awkwardblackgirl.com/episodes"><em>Misadventures</em></a> is good to watch as an evolutionary study. You see how <em>The Misadventures of Awkward Black Girl</em> has matured and evolved into <em>Insecure.</em> Also on its own the web-series is a quick watch that’s very funny, a different take on the image Hollywood presents of the black girl, and it has a ton of distinct and hilarious characters.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="eLVdyU5L5DdJDKa4XCqbLA" name="" alt="Issa Rae in Little" src="https://cdn.mos.cms.futurecdn.net/eLVdyU5L5DdJDKa4XCqbLA.jpg" mos="https://cdn.mos.cms.futurecdn.net/eLVdyU5L5DdJDKa4XCqbLA.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="little">Little</h2><p>Issa Rae co-stars with Regina Hall and Marsai Martin <a href="https://www.cinemablend.com/reviews/2469994/little-review" data-original-url="https://www.cinemablend.com/previews/2382872/little">in <em>Little</em>,</a> a story about a woman who reverts back to her childhood self after being cursed for being mean to a little girl. It’s <em>Big</em> and <em>13 Going on 30</em> in reverse. Rae plays April, Jordan (Regina Hall)’s assistant who ends up having to watch 13-year old Jordan (Marsai Martin).</p><p>This is an entertaining film that let’s each of the leads shine. Along with the main plot, it’s a story about April trying to be taken more seriously and have more responsibilities at work. <em>Little</em> has hilarious moments with each of the leads, making it a good watch if you want some lighthearted comedy.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="v4pCN3AuqmR6coCjD8KbDj" name="" alt="Issa Rae in The Hate u Give" src="https://cdn.mos.cms.futurecdn.net/v4pCN3AuqmR6coCjD8KbDj.jpg" mos="https://cdn.mos.cms.futurecdn.net/v4pCN3AuqmR6coCjD8KbDj.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="the-hate-u-give">The Hate U Give</h2><p><a href="https://www.cinemablend.com/reviews/2459718/the-hate-u-give-review" data-original-url="https://www.cinemablend.com/reviews/2459718/the-hate-u-give-review"><em>The Hate U Give</em> is</a> a drama based on the best selling book of the same name. It follows teen Starr (Amanda Stenberg) as she witnesses the murder of her unarmed black male friend, Khalil (Algee Smith). Khalil is murdered by a police officer, and the incident sparks unrest for Starr and her community.</p><p>Issa Rae plays April, a civil rights lawyer who encourages Starr to speak up about Khalil’s death, and the police’s involvement in it. The film takes a hard look at the injustices faced by black people, especially when it comes to police brutality. Rae’s part is small, but vital as she’s one of the people that helps inspire Starr to stand up for her rights and not let the police officer get away with Khalil’s murder.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="cDuLZYwzMGnJBoj4Kd9PcR" name="" alt="Issa Rae in Hair Love" src="https://cdn.mos.cms.futurecdn.net/cDuLZYwzMGnJBoj4Kd9PcR.jpg" mos="https://cdn.mos.cms.futurecdn.net/cDuLZYwzMGnJBoj4Kd9PcR.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="hair-love">Hair Love</h2><p><em>Hair Love</em> is the <a href="https://www.cinemablend.com/news/2489435/2020-academy-award-winners-a-complete-list" data-original-url="https://www.cinemablend.com/news/2489435/2020-academy-award-winners-a-complete-list">Academy Award winning</a> best animated short about a father trying to figure out how to do his young daughter’s hair. Rae narrates <a href="https://www.youtube.com/watch?v=kNw8V_Fkw28">the short</a> as the mother. Spoilers coming ahead.</p><p>The mother character is first only seen through a video watched by the daughter and father. By the end of the short, it’s revealed that she is in the hospital and has lost all her hair due to some type of illness. The father and daughter show her that she’s still beautiful and a queen even without hair. <em>Hair Love</em> makes you feel so many emotions in a short span of time, such as sadness, joy, inspiration, and triumph.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="MSNisF6iLSGym8Np4CvkYa" name="" alt="Lakeith Stanfield and Issa Rae in The Photograph" src="https://cdn.mos.cms.futurecdn.net/MSNisF6iLSGym8Np4CvkYa.jpg" mos="https://cdn.mos.cms.futurecdn.net/MSNisF6iLSGym8Np4CvkYa.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="the-photograph">The Photograph</h2><p><a href="https://www.cinemablend.com/reviews/2490191/the-photograph-review-two-love-stories-that-dont-develop-into-a-big-picture" data-original-url="https://www.cinemablend.com/reviews/2490191/the-photograph-review-two-love-stories-that-dont-develop-into-a-big-picture"><em>The Photograph</em> is</a> a romantic drama that follows two love stories, one set in the past and another in the present. The present one follows Mae (Issa Rae) and reporter Michael (Lakeith Stanfield). They meet because Michael is writing a story about a man who used to know her mother. The past love story follows Mae’s mother, Christina (Chante Adams) and Isaac (Y'lan Noel).</p><p><em>The Photograph</em> is about Mae learning Christina and Issac's love story, and using them as an example so that she won’t repeat their mistakes with Michael. The film focuses more on the characters than plot, and Rae does a great job of projecting Mae’s uncertainty about leaping fully into this new relationship.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="VApqGWVQPnRbEpQiXnuybf" name="" alt="Issa Rae in BoJack Horseman" src="https://cdn.mos.cms.futurecdn.net/VApqGWVQPnRbEpQiXnuybf.jpg" mos="https://cdn.mos.cms.futurecdn.net/VApqGWVQPnRbEpQiXnuybf.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="bojack-horseman-4">BoJack Horseman</h2><p>Issa Rae lends her voice to two episodes of BoJack Horseman Season 5. She plays Dr. Indira, Diane (Alison Brie)’s therapist. The first episode that she appears in is “The Dog Days Are Over,” which is only a brief appearance. In the episode, Dr. Indira not-so-subtly name drops some of her famous clients. She then has a larger role in “NT. SUB.” She has dinner with her wife, Mary-Beth (Wanda Sykes), and she shares an encounter that she had with Bojack Horseman (Will Arnett) and Diane.</p><p>The episode revolves around many of the main characters being turned into weird versions of themselves, because both spouses try to share their stories and encounters with these characters while trying to conceal their identities.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="GZ4RHD7cVeeAgiMDJddWtK" name="" alt="Issa Rae In Jay-Z's Moonlight Video" src="https://cdn.mos.cms.futurecdn.net/GZ4RHD7cVeeAgiMDJddWtK.jpg" mos="https://cdn.mos.cms.futurecdn.net/GZ4RHD7cVeeAgiMDJddWtK.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="jay-z-s-moonlight-music-video">Jay-Z’s Moonlight Music Video</h2><p>“Moonlight” features many young prominent black actors taking on <a href="https://www.cinemablend.com/television/1688809/friends-get-spoofed-with-all-black-actors-for-jay-zs-new-music-video-for-moonlight" data-original-url="https://www.cinemablend.com/television/1688809/friends-get-spoofed-with-all-black-actors-for-jay-zs-new-music-video-for-moonlight">roles of <em>Friends</em> characters.</a> Issa Rae plays Rachel, the role made famous by Jennifer Aniston. The <a href="https://www.youtube.com/watch?v=FCSh48OlvMo">song and video</a> address the <em>La La Land</em> and <em>Moonlight</em> Oscars controversy. The one where <a href="https://www.cinemablend.com/news/1629429/2017-academy-awards-oscar-winners-updated-live" data-original-url="https://www.cinemablend.com/news/1629429/2017-academy-awards-oscar-winners-updated-live"><em>Moonlight</em> won Best Picture</a> but <em>La La Land</em>’s name was read by mistake.</p><p>Many have spoken about <em>Moonlight</em>’s big win being overshadowed by the controversy of the whole situation. Jay-Z’s song takes it further by discussing the constant struggle of black artists and art to receive the same acclaim and recognition as white artists and art, even if it’s the exact same thing or better.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="QMxAmJaqkcNyVuGMESd3kQ" name="" alt="Issa Rae in Drake's Nice For What Video" src="https://cdn.mos.cms.futurecdn.net/QMxAmJaqkcNyVuGMESd3kQ.jpg" mos="https://cdn.mos.cms.futurecdn.net/QMxAmJaqkcNyVuGMESd3kQ.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="drake-s-nice-for-what-video">Drake’s Nice For What Video</h2><p>Drake’s “<a href="https://www.youtube.com/watch?v=U9BwWKXjVaI">Nice For What</a>” features famous women in various settings. Some of the women shown are Misty Copeland, Olivia Wilde, Rashida Jones, Tiffany Haddish, Tracee Ellis Ross, and Issa Rae. In Issa Rae’s scenes, she is at the head of the table in a room full of white, old men.</p><p>The song and video act as a tribute to strong independent women. It’s a cool video to watch for all the cameos, editing, and look at the variety of respected women in various fields, especially the entertainment industry.</p><p>If you can’t get enough of Issa Rae, she has a series with <a href="https://www.cinemablend.com/television/2495806/hbo-max-the-big-bang-theory-and-list-of-other-shows-streaming" data-original-url="https://www.cinemablend.com/television/2495806/hbo-max-the-big-bang-theory-and-list-of-other-shows-streaming">HBOMax called <em>Rap Sh*t</em></a> expected to premiere in 2020. Her hit HBO series <em>Insecure</em> is airing it’s fourth season every Sunday on HBO. <em>The Lovebirds</em> is also currently available to stream on Netflix. <strong>Stream it</strong> <a href="https://www.netflix.com/title/81248748"><strong>here</strong></a><strong>.</strong></p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ Why BoJack Horseman Season 6 Felt Like A Fitting Ending To The Netflix Show ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/2490436/why-bojack-horseman-season-6-felt-like-a-fitting-ending-to-the-netflix-show</link>
                                                                            <description>
                            <![CDATA[ Here's why Season 6 of Netflix's excellent BoJack Horseman was a fitting finale. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">tfxgVexvmWydVARinjaqcN</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/yeYZVSxwva2CYQ8wR9ptof-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Sat, 22 Feb 2020 17:00:00 +0000</pubDate>                                                                                                                                                                                                                                <category><![CDATA[Streaming News]]></category>
                                                                                                                    <dc:creator><![CDATA[ Will Ashton ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/aqwoJh4wdcBtBGxkz8Mpzk.png ]]></dc:source>
                                                                <dc:description><![CDATA[ null ]]></dc:description>
                                                                                                                                <cf:isSponsored>false</cf:isSponsored>
                <cf:hasAffiliateLinks>false</cf:hasAffiliateLinks>
                <cf:isPaid>false</cf:isPaid>
                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/yeYZVSxwva2CYQ8wR9ptof-1280-80.jpg">
                                                            <media:credit><![CDATA[null]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[Screenshot from Netflix&#039;s BoJack Horseman]]></media:description>                                                            <media:text><![CDATA[Screenshot from Netflix&#039;s BoJack Horseman]]></media:text>
                                <media:title type="plain"><![CDATA[Screenshot from Netflix&#039;s BoJack Horseman]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/yeYZVSxwva2CYQ8wR9ptof-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>In January, <em>BoJack Horseman</em> released <a href="https://www.cinemablend.com/television/2481223/why-is-netflixs-bojack-horseman-ending-aaron-paul-seems-to-have-a-different-explanation" data-original-url="https://www.cinemablend.com/television/2481223/why-is-netflixs-bojack-horseman-ending-aaron-paul-seems-to-have-a-different-explanation">its final episodes on Netflix</a>. Throughout the years, as the animated dramedy series progressed, it went from a lighthearted romp to one of the streaming giant's most acclaimed, beloved programs. For good reason, too. Created by Raphael Bob-Waksberg and <a href="https://www.cinemablend.com/television/2490245/netflix-puts-out-video-of-cast-celebrating-end-of-bojack-horseman-after-cancelling-show" data-original-url="https://www.cinemablend.com/television/2490245/netflix-puts-out-video-of-cast-celebrating-end-of-bojack-horseman-after-cancelling-show?pv=search">featuring the voice talents</a> of Will Arnett, Aaron Paul, Alison Brie, Amy Sedaris, and many others, <em>BoJack</em> was not only one of the smartest, funniest shows out there, but also <a href="https://www.cinemablend.com/television/2457791/bojack-horsemans-best-season-5-episode-is-another-format-breaking-masterpiece" data-original-url="https://www.cinemablend.com/television/2457791/bojack-horsemans-best-season-5-episode-is-another-format-breaking-masterpiece?pv=search">one of the most honest, devastating reflections</a> of addiction, trauma, and mental illness in any medium. That's certainly impressive for an animated sitcom about a talking alcoholic horse. Now, with Season 6 fully available to stream, it sadly reached <a href="https://www.cinemablend.com/television/2483868/bojack-horsemans-creator-thinks-its-a-shame-that-netflix-changed-its-cancellation-policy" data-original-url="https://www.cinemablend.com/television/2483868/bojack-horsemans-creator-thinks-its-a-shame-that-netflix-changed-its-cancellation-policy?pv=search">its bittersweet end.</a></p><p>Admittedly, <em>BoJack Horseman</em>'s final scenes weren't <a href="https://www.cinemablend.com/television/2487509/bojack-horseman-creator-has-some-blunt-thoughts-about-one-of-netflix-practices" data-original-url="https://www.cinemablend.com/television/2487509/bojack-horseman-creator-has-some-blunt-thoughts-about-one-of-netflix-practices?pv=search">what some anticipated.</a> For some, the subdued, somber finale was seen as too slight and anti-climatic, leaving the streaming series on <a href="https://www.cinemablend.com/television/2489982/how-bojack-horsemans-will-arnett-feels-about-saying-goodbye-to-the-netflix-comedy" data-original-url="https://www.cinemablend.com/television/2489982/how-bojack-horsemans-will-arnett-feels-about-saying-goodbye-to-the-netflix-comedy?pv=search">an oddly minor note</a>. While no finale will match every fan's expectations, <em>BoJack</em>'s final half-hour struck some as unexpectedly low-key — even for a show that prided itself on subverting expectations. That might not play to everyone's favor, but for me, it served as a lovely, authentic, moving, and fitting finale for <a href="https://www.rottentomatoes.com/tv/bojack_horseman/s06">one of the best shows on TV</a>. I don't expect everyone to agree, but I believe <em>BoJack Horseman</em>'s ending gave a great end to an exceptional series. Naturally, expect <strong>major</strong> <strong>spoilers</strong>.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="UEAQ4PPWFSaZTfvgDNW3Jj" name="" alt="Screenshot from Netflix's BoJack Horseman" src="https://cdn.mos.cms.futurecdn.net/UEAQ4PPWFSaZTfvgDNW3Jj.jpg" mos="https://cdn.mos.cms.futurecdn.net/UEAQ4PPWFSaZTfvgDNW3Jj.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="it-gave-bojack-horseman-a-chance-to-grow-and-mature-in-a-vital-way">It Gave BoJack Horseman A Chance To Grow And Mature In A Vital Way</h2><p>As BoJack Horseman continued his path of self-destructive behavior, it was clear that he needed to find some sort of redemption. No matter how funny and well-written the dramedy would be, if the show didn't find BoJack getting serious help for his substance abuse problems, <em>BoJack Horseman</em> would turn into a depressing, sorely repetitive look at an addict constantly failing to better himself as he struggles through middle age. The fifth season ended with BoJack checking into rehab, with the hopes of making constructive steps to better his dire life outlook and move away from his dependencies. It was an emotional finale that gave the mild hope that he'd finally get clean.</p><p>In <em>BoJack Horseman</em>'s two-part final season, we find our title character has surprisingly adapted to life in rehab — following initial resistance, of course. In fact, as the opening of the season shows, BoJack gets <em>too</em> comfortable with rehab, in your typical display of stunted growth. He's accepting clean living, but he's resistant to return to the world, where he's messed up more than his fair share of times. Horseman both lives in the past and remains haunted by it. But he exits rehab and tries to move forward. BoJack connects with Hollyhock, his half-sister, and discovers an unexpected interest in teaching. Specifically, in the theater program at Hollyhock's university. Once he gets the job, things look up for Ole' BoJack.</p><p>Nevertheless, unbeknownst to BoJack Horseman, there is a scandalous piece in the works that reveals the former <em>Horsin' Around</em> sitcom star was more directly involved with the death of his former child co-star, Sarah Lynn, than initially believed. Furthermore, in New York City, Hollyhock learns about BoJack's involvement in the disastrous New Mexico prom party, where (among other things) he got a teenager nearly fatally drunk.</p><p>It casts a shadow on BoJack and Hollyhock's relationship, even though Hollyhock never directly tells BoJack, which dampens what's easily some of BoJack's more productive years. As it turns out, being a professor suits BoJack well, and he develops a fertile teaching environment with his dedicated (if not always talented) students. Nevertheless, BoJack eventually gets wind of this brewing tidal wave of a story that's about to wreck his life. He tries to figure out a plan to fix it, but he decides to take responsibility instead.</p><p>As we watch BoJack's life spiral once more, he doesn't opt to avoid his problems. Instead, he takes provocative steps to continue bettering himself, even as his world crumbles apart. While he still makes mistakes and suffers the consequences, BoJack's delayed maturity is seen vividly in this final season, leading up to the melancholy, yet emotionally-satisfying, finale that doesn't promise you that BoJack's life will be fine, but it shows he has grown properly and he'll hopefully continue to do better in the future.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="MaS6qXUf3aiL9ZqeFneSLX" name="" alt="Screenshot from Netflix's BoJack Horseman" src="https://cdn.mos.cms.futurecdn.net/MaS6qXUf3aiL9ZqeFneSLX.jpg" mos="https://cdn.mos.cms.futurecdn.net/MaS6qXUf3aiL9ZqeFneSLX.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="bojack-horseman-continued-to-bring-the-laughs-and-emotional-punches-in-equal-measures-this-final-season">BoJack Horseman Continued To Bring The Laughs And Emotional Punches In Equal Measures This Final Season</h2><p>Above all else, <em>BoJack Horseman</em> is a comedy. Though it might not always seem it, the jokes always take precedence in the proceedings. Sure enough, while this final season definitely got heavy, in typical <em>BoJack Horseman</em> fashion, there were also lots of laugh-out-loud scenes. In addition to the laughs provided by Mr. Peanutbutter, Todd, and other lovable characters, we were introduced to a few new faces this season, notably Paige Sinclair (Paget Brewster) and Maximillian Banks (Max Greenfield) as old-fashioned reporters.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="Scx9bZa9LTQ2sAUiiqUmZF" name="" alt="Screenshot from Netflix's BoJack Horseman" src="https://cdn.mos.cms.futurecdn.net/Scx9bZa9LTQ2sAUiiqUmZF.jpg" mos="https://cdn.mos.cms.futurecdn.net/Scx9bZa9LTQ2sAUiiqUmZF.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="it-gave-proper-send-offs-to-the-supporting-characters-as-well">It Gave Proper Send-Offs To The Supporting Characters As Well</h2><p>Outside of its title character, <em>BoJack Horseman</em>'s appeal comes from its supporting ensemble, namely Mr. Peanutbutter, Todd, Diane, and Princess Carolyn. They all bring something special, and nearly all of them got fine farewells. While Mr. Peanutbutter's ending was arguably lackluster, the final season provided nice arcs for Todd, Diane, and Princess Carolyn to find the peace they've been searching for. Especially for Diane, with an episode focused on depression and anxiety struggles serving as a season highlight. Likewise, Princess Carolyn's need to companionship amid work and motherhood came to a lovely conclusion, while Todd's self-journey was lacking in comparison but filled with many delightfully Todd-esque moments.</p><p>Then, with the series finale, <em>BoJack Horseman</em> allowed its anthropomorphic lead to have a moment with each of them, eventually providing an emotional wallop with his reunion with Diane. In a scene that's confrontational-yet-emotionally honest, and filled with great wit and insight into their dynamic, it provided a proper circle to Season 1 and gave their relationship a definitive yet open-ended conclusion. The future will be filled with various journeys, but their time together has ended. While their final scene suggests things might not ever be good between them, it shows they've both found their happiness elsewhere or are on the path to healing.</p><p>It's not grandiose, but it's a tender, character-focused finale, allowing everyone to reflect on their journeys and find their paths to self-redemption, self-discovery, self-improvement, or self-fulfillment on their own tracks — all away from the company they've shared. Unlike the sitcoms it emulates, <em>BoJack Horseman</em> doesn't go for the sappy conclusion, but it echoes how those characters learn (or re-discover) that their time together is vital to who they are, and how they've grown. It's a keenly-realized way to end this series, as <em>BoJack</em> has always had a great sense of who these characters should be — in relation to both their place in the narrative and their individual/collective relationships to one another.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="n2UiCLR84QgSRJRzJaBda3" name="" alt="Screenshot from Netflix's BoJack Horseman" src="https://cdn.mos.cms.futurecdn.net/n2UiCLR84QgSRJRzJaBda3.jpg" mos="https://cdn.mos.cms.futurecdn.net/n2UiCLR84QgSRJRzJaBda3.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="bojack-horseman-never-lost-its-sense-of-self">BoJack Horseman Never Lost Its Sense Of Self</h2><p>In that same vein, where so many sitcoms — animated dramedies or otherwise — lose what makes them special, or become shells of themselves, <em>BoJack Horseman</em> only continued to be more confident, daring, and willing to be true to itself. It was a remarkable series, particularly as it grew to be more stylistic and narratively dense in its bold, thematic choices — while never losing what made it so captivating, even from its rocky beginning. Particularly as the shows it emulates lost their speed over time, <em>BoJack</em> never became "too much, man."</p><p>Instead, it continued to achieve excellence — even in its final season. Specifically, <em>BoJack Horseman</em> allowed itself to question the morality of its lead, and whether or not he deserves to find the happiness he seeks, which put the show's focus entirely on its head. But somehow, it never lost its stride.</p><p>One of the great joys in watching <em>BoJack Horseman</em> was discovering all the ways it continued to reinvent itself while never straying too far from its intentions. Even when BoJack's life choice were repetitively self-destructive, the show's individual flourishes — as well as its willing attitude to try different character beats and dynamic new perspectives — offered a fresh, lively series that constantly excelled. That stayed true until its subversively somber finale, which sacrificed the show's flair for bombastic, pun-friendly hijinks for something more emotionally searching and intensely gratifying in its own unexpected way. For a series centered around a drunk horseman, these final moments were oddly, movingly human, and it showed even more sides of these well-developed characters than we saw before.</p><p>Admittedly, I don't think <em>BoJack Horseman</em> Season 6 was flawless. The conclusion felt rushed; you sense that they wanted another season to properly bring closure. I also think the season's first half isn't as strong as its second, notably with the focus diverted between all the characters living disconnected lives. But thanks to its terrific final episodes, <em>BoJack</em> ends with a finale that's poignant, touching, grounded, reflective, and most of all, fitting of the series it now leaves behind. It's a shame to see it go. But thanks to this exceptional last season, at least it ends in a good, proper way.</p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ Netflix Puts Out Video Of Cast Celebrating End Of BoJack Horseman After Cancelling Show ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/2490245/netflix-puts-out-video-of-cast-celebrating-end-of-bojack-horseman-after-cancelling-show</link>
                                                                            <description>
                            <![CDATA[ The cast and crew have commemorated BoJack Horseman! ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">uHjzgwejAvenkPHDSrSFrD</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/VMQeSbc4TqfogZ6TnzCBWR-1280-80.png" type="image/png" length="0"></enclosure>
                                                                        <pubDate>Fri, 14 Feb 2020 20:59:11 +0000</pubDate>                                                                                                                                                                                                                                <category><![CDATA[Streaming News]]></category>
                                                                                                                    <dc:creator><![CDATA[ Britt Lawrence ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/nZc7U9xPWeMriqycZdeEEo.png ]]></dc:source>
                                                                <dc:description><![CDATA[ null ]]></dc:description>
                                                                                                                                <cf:isSponsored>false</cf:isSponsored>
                <cf:hasAffiliateLinks>false</cf:hasAffiliateLinks>
                <cf:isPaid>false</cf:isPaid>
                                                                                                                                <media:content type="image/png" url="https://cdn.mos.cms.futurecdn.net/VMQeSbc4TqfogZ6TnzCBWR-1280-80.png">
                                                            <media:credit><![CDATA[Netflix]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[BoJack Horseman Will Arnett Netflix]]></media:description>                                                            <media:text><![CDATA[BoJack Horseman Will Arnett Netflix]]></media:text>
                                <media:title type="plain"><![CDATA[BoJack Horseman Will Arnett Netflix]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/VMQeSbc4TqfogZ6TnzCBWR-1280-80.png" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>Despite critical acclaim and open <a href="https://www.cinemablend.com/television/2475022/hulu-reveals-its-3-favorite-netflix-shows-and-wants-netflix-to-play-along" data-original-url="https://www.cinemablend.com/television/2475022/hulu-reveals-its-3-favorite-netflix-shows-and-wants-netflix-to-play-along">adoration from a rival streamer</a>, Netflix decided to cancel fan-favorite <em>BoJack Horseman</em>. It is <a href="https://www.cinemablend.com/television/2475976/all-the-netflix-shows-that-have-been-cancelled-in-2019-so-far" data-original-url="https://www.cinemablend.com/television/2475976/all-the-netflix-shows-that-have-been-cancelled-in-2019-so-far">one of many shows</a> that have met a shocking and arguably premature end at the streamer. Now that <em>BoJack Horseman’s</em> sixth and final season is streaming, Netflix has put together a sweet commemorative video for the series.</p><p>If you are a <em>BoJack Horseman</em> fan, it is safe to say that this is <a href="https://www.youtube.com/watch?v=8kk4dsa6F5A">a Netflix video</a> (which you can find below) you will want to check out. <em>BoJack Horseman</em>'s creator, Raphael Bob-Waksberg, explained what viewers have come up to him and said, saying:</p><div><blockquote><p>People come up to me, and they tell me that it has given them the vocabulary to talk about feelings that they have had. Relationships that they never quite understood. It’s really incredible, and it makes me tremendously proud.</p></blockquote></div><p>The power of <em>BoJack Horseman</em> is real! The animated series has long been a staple of critics’ <a href="https://www.cinemablend.com/television/2464282/the-10-best-tv-shows-of-2018-according-to-nick" data-original-url="https://www.cinemablend.com/television/2464282/the-10-best-tv-shows-of-2018-according-to-nick">best of the year</a> lists and will be missed by many, including its cast. In reflecting on the show, showrunner Raphael Bob-Waksberg also shared some insight into the ensemble’s reaction as <em>BoJack Horseman</em> grew darker. On the cast’s response to the pilot and ensuing season, Bob-Waksberg said:</p><div><blockquote><p>We, as writers, go to darker places because we can. Because it doesn’t feel too dark because the show is so bright. It’s emotional and vulnerable and sticky and prickly. I don’t think we told the actors that that was the plan. The actors all signed up for the first episode that they read, which is like a pilot episode like ‘yeah, this sounds fun.’ One of my delights in that first season was going to these table reads where things got progressively darker and seeing the actors kind of look at each other like ‘what did we sign up for?’ But they loved it! [laughs] I mean, they were into it. It was fun to surprise them.</p></blockquote></div><p>Thankfully, it all worked out, and <em>BoJack Horseman</em> became a <a href="https://www.cinemablend.com/television/2486865/12-terrific-shows-coming-to-netflix-in-january-2020" data-original-url="https://www.cinemablend.com/television/2486865/12-terrific-shows-coming-to-netflix-in-january-2020">much-anticipated release</a> during its six seasons. Thus, making news of its cancellation all the more upsetting. As questions began to circulate about why <em>BoJack Horseman</em> would end with Season 6, voice actor Aaron Paul <a href="https://www.cinemablend.com/television/2481223/why-is-netflixs-bojack-horseman-ending-aaron-paul-seems-to-have-a-different-explanation" data-original-url="https://www.cinemablend.com/television/2481223/why-is-netflixs-bojack-horseman-ending-aaron-paul-seems-to-have-a-different-explanation">offered an explanation</a>. Paul cited Netflix as making the call to end the series.</p><p><em>BoJack Horseman</em> boss Raphael Bob-Waksberg later sounded off on Netflix’s <a href="https://www.cinemablend.com/television/2483868/bojack-horsemans-creator-thinks-its-a-shame-that-netflix-changed-its-cancellation-policy" data-original-url="https://www.cinemablend.com/television/2483868/bojack-horsemans-creator-thinks-its-a-shame-that-netflix-changed-its-cancellation-policy">altered cancellation policy</a>. At the time, Bob-Waksberg lamented Netflix recently seeming to move away from its previous model of waiting for new shows to build an audience. The series’ creator has also commented on the streamer’s practice of <a href="https://www.cinemablend.com/television/2487509/bojack-horseman-creator-has-some-blunt-thoughts-about-one-of-netflix-practices" data-original-url="https://www.cinemablend.com/television/2487509/bojack-horseman-creator-has-some-blunt-thoughts-about-one-of-netflix-practices">skipping the ending credits</a>.</p><p>Speaking of end credits, <em>BoJack Horseman</em> has officially concluded as of Season 6. Will Arnett, who voices BoJack, previously opened up about his feelings <a href="https://www.cinemablend.com/television/2489982/how-bojack-horsemans-will-arnett-feels-about-saying-goodbye-to-the-netflix-comedy" data-original-url="https://www.cinemablend.com/television/2489982/how-bojack-horsemans-will-arnett-feels-about-saying-goodbye-to-the-netflix-comedy">surrounding saying goodbye</a> to <em>BoJack Horseman</em>. In a sign of how positive his experience was working on the Netflix comedy, he mentioned himself, fellow cast members, and Raphael Bob-Waksberg wanting to collaborate again.</p><p>What does Will Arnett have to say about <em>BoJack Horseman</em> in the poignant farewell video? In it, Arnett reflected on people’s initial expectations of <a href="https://www.cinemablend.com/television/2487346/the-10-best-netflix-original-tv-shows-of-2019" data-original-url="https://www.cinemablend.com/television/2487346/the-10-best-netflix-original-tv-shows-of-2019">the highly-regarded series</a> and that it would another show about showbusiness. As for his favorite part of BoJack’s journey, Arnett had this to say:</p><div><blockquote><p>My favorite part of BoJack’s journey. My answer, I think, changed every year. But now looking back at all of it, he legitimately was looking for some relief, and I like the idea that he does ultimately end up getting a little bit of peace.</p></blockquote></div><p>You can watch Will Arnett, Aaron Paul, Alison Brie, Paul F. Tompkins, and more, reflect in the full video below. There are quite a few moving insights that <em>BoJack Horseman’s</em> cast and crew have to share about the show, including its impact on viewers. Check it out here:</p><div class="youtube-video" data-nosnippet ><div class="video-aspect-box"><iframe data-lazy-priority="high" data-lazy-src="https://www.youtube-nocookie.com/embed/8kk4dsa6F5A" allowfullscreen></iframe></div></div><p>Only time will tell if the team that made <em>BoJack Horseman</em> such a hit with so many viewers will ever get to collaborate again. A <em>BoJack</em> revival may not be in the cards, but anything can happen when it comes to Netflix nowadays.</p><div  class="fancy-box"><div class="fancy_box-title">Up next: <a href="https://www.cinemablend.com/television/2487671/16-most-disappointing-tv-cancellations-of-2019" data-original-url="https://www.cinemablend.com/television/2487671/16-most-disappointing-tv-cancellations-of-2019"><u><strong>The 16 Most Disappointing TV Cancellations Of 2019</strong></u></a></div><div class="fancy_box_body"><figure class="van-image-figure "  ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="" name="" caption="" alt="" src="https://img.cinemablend.com/quill/5/5/c/4/6/f/55c46f2dc54add783e1b183a60990b3c7c2af385.png" mos="" link="" align="" fullscreen="" width="0" height="0" attribution="" endorsement="" class="pinterest-pin-exclude"></p></div></div></figure></div></div><p><em>BoJack Horseman</em> is available to stream in entirety on Netflix along, with <a href="https://www.cinemablend.com/television/2485936/2020-netflix-schedule-premiere-dates-for-new-and-returning-shows" data-original-url="https://www.cinemablend.com/television/2485936/2020-netflix-schedule-premiere-dates-for-new-and-returning-shows">lots of 2020 content</a>. If you need something to binge or get your mind off of the beloved series’ cancellation, there are always <a href="https://www.cinemablend.com/television/2484766/2020-winter-and-spring-tv-schedule-premiere-dates-for-network-cable-and-streaming-shows" data-original-url="https://www.cinemablend.com/television/2484766/2020-winter-and-spring-tv-schedule-premiere-dates-for-network-cable-and-streaming-shows">this winter and spring’s premieres</a>.</p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ How BoJack Horseman's Will Arnett Feels About Saying Goodbye To The Netflix Comedy ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/2489982/how-bojack-horsemans-will-arnett-feels-about-saying-goodbye-to-the-netflix-comedy</link>
                                                                            <description>
                            <![CDATA[ Many Netflix subscribers out there have been sorry to see BoJack Horseman going away, and here's how series star Will Arnett feels about it. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">xzvRdYrA51XPJTGwuSnkma</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/D4GWd7Zvdcoj6stwN6ruXA-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Tue, 11 Feb 2020 16:40:23 +0000</pubDate>                                                                                                                                                                                                                                <category><![CDATA[Streaming News]]></category>
                                                                                                                    <dc:creator><![CDATA[ Nick Venable ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/TzeQjfZT5cKqHRsEqudtqT.png ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Nick Venable is an Assistant Managing Editor, and the TV Editor. His humble origin story with CinemaBlend began all the way back in the pre-streaming era, circa 2009, as a freelancing DVD reviewer and TV recapper. After rising up through the ranks covering Movies, Nick leapfrogged over to the small screen to cover more and more television news and interviews, eventually taking over the section for the current era. Born in Louisiana and currently living in Texas — Who Dat Nation over America’s Team all day, all night — Nick spent several years in the hospitality industry, and also worked as a 911 operator. And if you ever happened to hear his music or read his comics/short stories, you have his sympathy. His love for his wife and daughters is almost equaled by his love of gasp-for-breath laughter and gasp-for-breath horror. A lifetime spent in the vicinity of a television screen led to his current dream job, as well as his knowledge of too many TV themes and ad jingles.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What He&#039;s Into&lt;/strong&gt;: Nick is one of those people who won’t necessarily insert a Monty Python reference into every conversation, but is still mentally equipped to do so. Beyond such appreciation for surreal UK comedy, Nick also indulges in as much horror splendor as possible, from Stephen King novels to James Tynion IV comics to Freddy Krueger one-liners to all things Mike Flanagan. Throw in a dash of NFL, some 311 and Weird Al, fried crawfish poboys, bourbon, ‘90s-era pro wrestling, crossword puzzles and mystery-driven video games, and baby, you got a stew going. (Nick will insert an Arrested Development reference into every conversation, if possible.)&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What He&#039;s Excited About&lt;/strong&gt;: Anything Jeff Lemire, Tom King and W. Maxwell Prince think of, ever. More of Kelly Reilly’s deliriously fierce performances on Yellowstone. HBO’s The Last of Us. Clone High’s return. Colin Farrell’s Penguin being in every movie/TV show/breakfast cereal.&lt;/p&gt; ]]></dc:description>
                                                                                                                                <cf:isSponsored>false</cf:isSponsored>
                <cf:hasAffiliateLinks>false</cf:hasAffiliateLinks>
                <cf:isPaid>false</cf:isPaid>
                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/D4GWd7Zvdcoj6stwN6ruXA-1280-80.jpg">
                                                            <media:credit><![CDATA[netflix press]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[bojack horseman season 6 bojack talking to princess carolyn]]></media:description>                                                            <media:text><![CDATA[bojack horseman season 6 bojack talking to princess carolyn]]></media:text>
                                <media:title type="plain"><![CDATA[bojack horseman season 6 bojack talking to princess carolyn]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/D4GWd7Zvdcoj6stwN6ruXA-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>Until recently, <em>BoJack Horseman</em> was the only remaining Netflix original from the streaming service's first wave of scripted programming, with the animated series having outlasted the runs of contemporaries such as <em>House of Cards</em> and <em>Orange in the New Black</em>. (Even if Kevin Spacey continues to <a href="https://www.cinemablend.com/television/2487451/kevin-spacey-put-out-another-weird-video-as-house-of-cards-frank-underwood" data-original-url="https://www.cinemablend.com/television/2487451/kevin-spacey-put-out-another-weird-video-as-house-of-cards-frank-underwood">run with his Frank Underwood character</a>.) Regardless, Netflix did pull the plug on the dark-as-night comedy, which closed out its Hollywoo-skewing sixth season in January. Yet someone who hasn't said much about <em>BoJack</em>'s swan song is the star himself, Will Arnett.</p><p>A performer who presumably doesn't have time to do a lot of press since he's got 17 projects always in motion, Will Arnett does indeed have a new BBC comedy on the way dubbed <em>The First Team</em>. It was while he was handling some promotion for that series that he broached the topic of <em>BoJack</em>'s end. In his words:</p><div><blockquote><p>It’s bittersweet. I feel satisfied with what we did. [Creator Raphael Bob-Waksberg] is an incredible writer and I feel fortunate I got to be a part of something like that, and ride his coattails a bit. . . . Last week, we had a little screening in L.A. and Raphael, [Paul F. Tompkins] and [Aaron Paul] and I were talking. We were like, ‘What (else) can we do?’ We’re always doing that because it’s hard to let go.</p></blockquote></div><p>Okay, so exactly where is the dotted line that I can sign in order to bring Will Arnett, Paul F. Tompkins and Aaron Paul back together with Raphael Bob-Waksberg? And is there room to write in other much-needed actors' names, such as Allison Brie and Amy Sedaris? I mean seriously, if all of those creative minds and voices got together for another series in the aftermath of <em>BoJack Horseman</em>'s finale, that <em>might</em> loosen up some of the <a href="https://www.cinemablend.com/television/2487671/16-most-disappointing-tv-cancellations-of-2019" data-original-url="https://www.cinemablend.com/television/2487671/16-most-disappointing-tv-cancellations-of-2019">ill feelings that still remain</a> just from its cancellation announcement. (You might recall Bob-Waksberg <a href="https://www.cinemablend.com/television/2483868/bojack-horsemans-creator-thinks-its-a-shame-that-netflix-changed-its-cancellation-policy" data-original-url="https://www.cinemablend.com/television/2483868/bojack-horsemans-creator-thinks-its-a-shame-that-netflix-changed-its-cancellation-policy">was pretty vocal about it</a>, among <a href="https://www.cinemablend.com/television/2487509/bojack-horseman-creator-has-some-blunt-thoughts-about-one-of-netflix-practices" data-original-url="https://www.cinemablend.com/television/2487509/bojack-horseman-creator-has-some-blunt-thoughts-about-one-of-netflix-practices">other things involving Netflix</a>.)</p><p>Noting to <a href="https://variety.com/2020/tv/actors/will-arnett-bojack-horseman-the-first-team-jurgen-klopp-liverpool-1203499169/">Variety</a> that he has been happy with all the fan reactions he has seen for the finale, Will Arnett talked about <em>BoJack Horseman</em> holding a special place in his career, saying:</p><div><blockquote><p>You do so many things over the course of your life and (when) you realize you’re part of something that’s really quite special, it’s important to take a moment to recognize it.</p></blockquote></div><p>No other TV show will ever be able to pull off everything that <em>BoJack Horseman</em> did, from the sharp-edged look at the entertainment industry to the <a href="https://www.cinemablend.com/television/2457791/bojack-horsemans-best-season-5-episode-is-another-format-breaking-masterpiece" data-original-url="https://www.cinemablend.com/television/2457791/bojack-horsemans-best-season-5-episode-is-another-format-breaking-masterpiece">brutally honest takes on family life (and death)</a> to the absolutely amazing examples of alliteration and tongue twisters. Hell, no non-<em>BoJack</em> show will ever even have another Judah. Isn't that right, Judah?</p><p>Thankfully, all six seasons of <em>BoJack Horseman</em> will always be available to stream for anyone who has Netflix, so the characters will never <em>really</em> be gone from our lives. While waiting patiently to hear about more, and while hoping against any other <a href="https://www.cinemablend.com/television/2489933/netflix-cancelled-spinning-out-right-after-it-premiered-but-fans-are-fighting-back" data-original-url="https://www.cinemablend.com/television/2489933/netflix-cancelled-spinning-out-right-after-it-premiered-but-fans-are-fighting-back">Netflix cancellations to drop</a>, head to our <a href="https://www.cinemablend.com/television/2484766/2020-winter-and-spring-tv-schedule-premiere-dates-for-network-cable-and-streaming-shows" data-original-url="https://www.cinemablend.com/television/2484766/2020-winter-and-spring-tv-schedule-premiere-dates-for-network-cable-and-streaming-shows">Winter and Spring TV premiere</a> schedule to see what new shows are on the way.</p><div  class="fancy-box"><div class="fancy_box-title">Up next: <a href="https://www.cinemablend.com/television/2487705/all-the-tv-shows-that-are-cancelled-and-ending-in-2020" data-original-url="https://www.cinemablend.com/television/2487705/all-the-tv-shows-that-are-cancelled-and-ending-in-2020"><u><strong>All The TV Shows That Are Cancelled And Ending In 2020</strong></u></a></div><div class="fancy_box_body"><figure class="van-image-figure "  ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="" name="" caption="" alt="" src="https://img.cinemablend.com/quill/3/d/7/6/6/9/3d766980138572ed3eb5c3a1c6900f296aa1a31b.jpg" mos="" link="" align="" fullscreen="" width="0" height="0" attribution="" endorsement="" class="pinterest-pin-exclude"></p></div></div></figure></div></div>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ All The TV Shows That Are Cancelled And Ending In 2020 ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/2487705/all-the-tv-shows-that-are-cancelled-and-ending-in-2020</link>
                                                                            <description>
                            <![CDATA[ 2020 just started, but we already know about a ton of TV shows that are coming to an end. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">hnSg8TGigRTayBzm2WZMr2</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/YtKJm5HH94zZjpHNBEk9wm-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Wed, 08 Jan 2020 18:37:26 +0000</pubDate>                                                                                                                                                                                                                                <category><![CDATA[Television]]></category>
                                                                                                                    <dc:creator><![CDATA[ Nick Venable ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/TzeQjfZT5cKqHRsEqudtqT.png ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Nick Venable is an Assistant Managing Editor, and the TV Editor. His humble origin story with CinemaBlend began all the way back in the pre-streaming era, circa 2009, as a freelancing DVD reviewer and TV recapper. After rising up through the ranks covering Movies, Nick leapfrogged over to the small screen to cover more and more television news and interviews, eventually taking over the section for the current era. Born in Louisiana and currently living in Texas — Who Dat Nation over America’s Team all day, all night — Nick spent several years in the hospitality industry, and also worked as a 911 operator. And if you ever happened to hear his music or read his comics/short stories, you have his sympathy.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What He&#039;s Into&lt;/strong&gt;: Nick is one of those people who won’t necessarily insert a Monty Python reference into every conversation, but is still mentally equipped to do so. Beyond such appreciation for surreal UK comedy, Nick also indulges in as much horror splendor as possible, from Stephen King novels to James Tynion IV comics to Freddy Krueger one-liners to all things Mike Flanagan. Throw in a dash of NFL, some 311 and Weird Al, fried crawfish poboys, bourbon, ‘90s-era pro wrestling, crossword puzzles and mystery-driven video games, and baby, you got a stew going. (Nick will insert an Arrested Development reference into every conversation, if possible.)&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What He&#039;s Excited About&lt;/strong&gt;: Anything Jeff Lemire, Tom King and W. Maxwell Prince think of, ever. More of Kelly Reilly’s deliriously fierce performances on Yellowstone. HBO’s The Last of Us. Clone High’s return. Colin Farrell’s Penguin being in every movie/TV show/breakfast cereal.&lt;/p&gt; ]]></dc:description>
                                                                                                                                <cf:isSponsored>false</cf:isSponsored>
                <cf:hasAffiliateLinks>false</cf:hasAffiliateLinks>
                <cf:isPaid>false</cf:isPaid>
                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/YtKJm5HH94zZjpHNBEk9wm-1280-80.jpg">
                                                            <media:credit><![CDATA[null]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[lucifer]]></media:description>                                                            <media:text><![CDATA[lucifer]]></media:text>
                                <media:title type="plain"><![CDATA[lucifer]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/YtKJm5HH94zZjpHNBEk9wm-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>TV fans lost <a href="https://www.cinemablend.com/television/2487671/16-most-disappointing-tv-cancellations-of-2019" data-original-url="https://www.cinemablend.com/television/2487671/16-most-disappointing-tv-cancellations-of-2019">a lot of great TV shows in 2019</a>, as well as a <a href="https://www.cinemablend.com/television/2487681/the-biggest-tv-deaths-of-2019" data-original-url="https://www.cinemablend.com/television/2487681/the-biggest-tv-deaths-of-2019">lot of great TV characters</a>, and because the cycle of entertainment life is never-ending, 2020 will deliver an equally sizable batch of series going away. From shows that had long-planned wrap-ups (such as <em>Criminal Minds</em>) to series whose endings were ordered up far more suddenly (such as <em>Anne with an E</em>), the list of soon-to-exit series is filled with stuff that fans will hate to say goodbye to.</p><p>What follows is a list of all the major TV shows that were either unceremoniously given the axe or had an exit plan already in place for 2020. Let us know in the comments which shows you'll miss the most.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="a4brj52xBA4Tis33RXCeW9" name="" alt="agents of shield" src="https://cdn.mos.cms.futurecdn.net/a4brj52xBA4Tis33RXCeW9.jpg" mos="https://cdn.mos.cms.futurecdn.net/a4brj52xBA4Tis33RXCeW9.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: abc press)</span></figcaption></figure><h2 id="agents-of-s-h-i-e-l-d-abc">Agents Of S.H.I.E.L.D. (ABC)</h2><p>The lengthiest Marvel TV series to date, <em>Agents of S.H.I.E.L.D.</em> is coming to <a href="https://www.cinemablend.com/television/2476734/agents-of-shield-ending-with-season-7-becoming-rare-marvel-series-to-not-get-cancelled" data-original-url="https://www.cinemablend.com/television/2476734/agents-of-shield-ending-with-season-7-becoming-rare-marvel-series-to-not-get-cancelled">an amicable and planned end</a> at ABC with Season 7, giving fans hope that Clark Gregg, Ming-Na Wen, Chloe Bennett and the rest of the cast get to close this increasingly complex mythos out <a href="https://www.cinemablend.com/television/2479535/why-marvels-agents-of-shield-ending-after-season-7-is-a-good-thing" data-original-url="https://www.cinemablend.com/television/2479535/why-marvels-agents-of-shield-ending-after-season-7-is-a-good-thing">in satisfying ways</a>.</p><p><strong>When Will Agents of S.H.I.E.L.D. End?</strong> The 13-episode Season 7 is set to premiere in mid-2020.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="FWYMQAyYR9RR6VHhfyPuYZ" name="" alt="anne with an E season 3" src="https://cdn.mos.cms.futurecdn.net/FWYMQAyYR9RR6VHhfyPuYZ.jpg" mos="https://cdn.mos.cms.futurecdn.net/FWYMQAyYR9RR6VHhfyPuYZ.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: netflix press)</span></figcaption></figure><h2 id="anne-with-an-e-netflix">Anne With An E (Netflix)</h2><p>Based on the beloved <em>Anne of Green Gables</em> novels by Lucy Maud Montgomery, <a href="https://www.cinemablend.com/television/2485603/fans-are-devastated-after-surprise-netflix-cancellation-of-anne-with-an-e" data-original-url="https://www.cinemablend.com/television/2485603/fans-are-devastated-after-surprise-netflix-cancellation-of-anne-with-an-e"><em>Anne with an E</em> was cancelled</a> by Netflix not long ahead of <a href="https://www.cinemablend.com/television/2486865/12-terrific-shows-coming-to-netflix-in-january-2020" data-original-url="https://www.cinemablend.com/television/2486865/12-terrific-shows-coming-to-netflix-in-january-2020">its January premiere</a>, and though fans and the creator <a href="https://www.cinemablend.com/television/2485670/could-cancelled-anne-with-an-e-get-a-movie-to-wrap-up" data-original-url="https://www.cinemablend.com/television/2485670/could-cancelled-anne-with-an-e-get-a-movie-to-wrap-up">hold out hope for a movie</a> to close things out, nothing has been reported just yet.</p><p><strong>When Did Anne with an E End?</strong> Netflix premiered the third and final season on January 3.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="XAKYWSVruSbWnZgYhbVJrJ" name="" alt="arrow season 8 sad oliver" src="https://cdn.mos.cms.futurecdn.net/XAKYWSVruSbWnZgYhbVJrJ.jpg" mos="https://cdn.mos.cms.futurecdn.net/XAKYWSVruSbWnZgYhbVJrJ.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: the cw press)</span></figcaption></figure><h2 id="arrow-the-cw">Arrow (The CW)</h2><p>The foundation of The CW's impressively expansive superhero universe, <em>Arrow</em> is bidding the world goodbye with its multiverse-crossing Season 8, allowing an <a href="https://www.cinemablend.com/television/2484801/arrow-wrapped-filming-on-final-season-and-the-stars-are-sharing-lots-of-heartfelt-farewells" data-original-url="https://www.cinemablend.com/television/2484801/arrow-wrapped-filming-on-final-season-and-the-stars-are-sharing-lots-of-heartfelt-farewells">emotional Stephen Amell</a> and the rest of the cast to bow out <a href="https://www.cinemablend.com/television/2486324/every-arrow-verse-cameo-from-the-crisis-on-infinite-earths-crossover-so-far" data-original-url="https://www.cinemablend.com/television/2486324/every-arrow-verse-cameo-from-the-crisis-on-infinite-earths-crossover-so-far?pv=search">with DC Comics swagger</a>. Will the rest of the shows be able to last without the flagship hero Green Arrow?</p><p><strong>When Will Arrow End?</strong> The series finale is set for Tuesday, January 28.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="MmjAsxk5pdWdbY3knwiE3G" name="" alt="blindspot season 5" src="https://cdn.mos.cms.futurecdn.net/MmjAsxk5pdWdbY3knwiE3G.png" mos="https://cdn.mos.cms.futurecdn.net/MmjAsxk5pdWdbY3knwiE3G.png" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: nbc press)</span></figcaption></figure><h2 id="blindspot-nbc">Blindspot (NBC)</h2><p>After four somewhat ratings-troubled seasons, NBC's twisty tattoo-centered mystery <em>Blindspot</em> will close things out with <a href="https://www.cinemablend.com/television/2474247/how-the-blindspot-finale-shocker-set-up-a-celebratory-final-season-5" data-original-url="https://www.cinemablend.com/television/2474247/how-the-blindspot-finale-shocker-set-up-a-celebratory-final-season-5">a "celebratory" Season 5</a> that will hopefully answer everything that needs answering.</p><p><strong>When Will Blindspot End?</strong> The fifth and final season is set to debut in mid-2020.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="Aev98LUyBpPv7rY7MEbqhZ" name="" alt="bojack horseman looking into mirror season 6" src="https://cdn.mos.cms.futurecdn.net/Aev98LUyBpPv7rY7MEbqhZ.jpg" mos="https://cdn.mos.cms.futurecdn.net/Aev98LUyBpPv7rY7MEbqhZ.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: netflix press)</span></figcaption></figure><h2 id="bojack-horseman-netflix-4">BoJack Horseman (Netflix)</h2><p>Netflix's first original comedy, <em>BoJack Horseman</em> is going to the booze-soaked farm after six seasons of the most hilarious emotional trauma that tongue-twisting animated animals could deliver. (Not the most friendly parting though, considering <a href="https://www.cinemablend.com/television/2487509/bojack-horseman-creator-has-some-blunt-thoughts-about-one-of-netflix-practices" data-original-url="https://www.cinemablend.com/television/2487509/bojack-horseman-creator-has-some-blunt-thoughts-about-one-of-netflix-practices">the creator's post-parting thoughts</a>.)</p><p><strong>When Will BoJack Horseman End?</strong> The eight episodes comprising Season 6 Part 2 will debut on Friday, January 31.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="yu3UcP5mHVBuam2pd5EzKn" name="" alt="brockmire season 3 jim and charles in hotel room" src="https://cdn.mos.cms.futurecdn.net/yu3UcP5mHVBuam2pd5EzKn.jpg" mos="https://cdn.mos.cms.futurecdn.net/yu3UcP5mHVBuam2pd5EzKn.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: ifc press)</span></figcaption></figure><h2 id="brockmire-ifc">Brockmire (IFC)</h2><p>Hank Azaria's disgraced baseball announcer will get his redemption (or whatever the opposite of that is) when <em>Brockmire</em> concludes its fourth and final season, with its cancellation getting announced in December 2019, a few months ahead of the premiere.</p><p><strong>When Will Brockmire End?</strong> IFC is set to premiere Season 4 in March 2020.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="hqqtw8L5ZnRW5nW7akTrhC" name="" alt="claws season 3 cast lineup" src="https://cdn.mos.cms.futurecdn.net/hqqtw8L5ZnRW5nW7akTrhC.png" mos="https://cdn.mos.cms.futurecdn.net/hqqtw8L5ZnRW5nW7akTrhC.png" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="claws-tnt">Claws (TNT)</h2><p>Dwindling numbers were likely to blame for the cancellation of TNT's crime dramedy <em>Claws</em>, though its acclaim and its passionate fandom earned the show a fourth and final season to follow the cancellation.</p><p><strong>When Will Claws End?</strong> No details have been revealed just about when Season 4 will drop on TNT.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="SA5AhP2UTDwgNQtUdDFtSX" name="" alt="corporate" src="https://cdn.mos.cms.futurecdn.net/SA5AhP2UTDwgNQtUdDFtSX.jpg" mos="https://cdn.mos.cms.futurecdn.net/SA5AhP2UTDwgNQtUdDFtSX.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: comedy central press)</span></figcaption></figure><h2 id="corporate-comedy-central">Corporate (Comedy Central)</h2><p>While never a ratings winner by most stretches of the imagination, Comedy Central's <em>Corporate</em> stands out as one of the network's most incisive comedies in recent years, and its third and final season will presumably leave cuts as sharp as <em>South Park</em>'s strongest runs.</p><p><strong>When Will Corporate End?</strong> No news yet about when Season 3 will arrive on Comedy Central.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="CCi8uYo2Z4Tkjg52Jtt8uQ" name="" alt="criminal minds season 15" src="https://cdn.mos.cms.futurecdn.net/CCi8uYo2Z4Tkjg52Jtt8uQ.jpg" mos="https://cdn.mos.cms.futurecdn.net/CCi8uYo2Z4Tkjg52Jtt8uQ.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="criminal-minds-cbs">Criminal Minds (CBS)</h2><p>Though the show's audience wasn't the same after the Thomas Gibson debacle, <em>Criminal Minds</em>' status as a signature CBS drama can't be challenged as it goes into <a href="https://www.cinemablend.com/television/2487921/why-criminals-minds-final-season-probably-wont-end-with-big-changes-and-major-deaths" data-original-url="https://www.cinemablend.com/television/2487921/why-criminals-minds-final-season-probably-wont-end-with-big-changes-and-major-deaths">its 10-episode final season</a>. (Which, interestingly enough, was filmed almost immediately following production on Season 14, given the in-advance notice given by CBS.)</p><p><strong>When Will Criminal Minds End?</strong> CBS will premiere Season 15 on Wednesday, January 8.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="n3HCtHWqNNrtk4C68YKD5X" name="" alt="dark cast netflix" src="https://cdn.mos.cms.futurecdn.net/n3HCtHWqNNrtk4C68YKD5X.jpg" mos="https://cdn.mos.cms.futurecdn.net/n3HCtHWqNNrtk4C68YKD5X.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: netflix press)</span></figcaption></figure><h2 id="dark-netflix">Dark (Netflix)</h2><p>One of <a href="https://www.cinemablend.com/television/1731460/dark-review-netflixs-german-answer-to-stranger-things-is-appropriately-titled-and-far-more-grim" data-original-url="https://www.cinemablend.com/television/1731460/dark-review-netflixs-german-answer-to-stranger-things-is-appropriately-titled-and-far-more-grim">Netflix's darkest series</a>, appropriately enough, <em>Dark</em> had its fate sealed even before its second season premiered in 2019, with the streaming service choosing to end the German sci-fi thriller with Season 3.</p><p><strong>When Will Dark End?</strong> Nothing has been revealed just yet for when Season 3 will debut, but later in 2020 is more likely, considering the year-and-a-half wait between the first two seasons.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="GC48qh6PXL4eHVftenDcc6" name="" alt="dear white people season 3" src="https://cdn.mos.cms.futurecdn.net/GC48qh6PXL4eHVftenDcc6.jpg" mos="https://cdn.mos.cms.futurecdn.net/GC48qh6PXL4eHVftenDcc6.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: netflix press)</span></figcaption></figure><h2 id="dear-white-people-netflix">Dear White People (Netflix)</h2><p>Based on Justin Simien's film of the same name, the culturally sensitive comedy <em>Dear White People</em> was given a fourth season endgame by Netflix back in October, so fans can look forward to seeing how Logan Browning's Samantha White wraps her vocal and poignant arc.</p><p><strong>When Will Dear White People End?</strong> While Netflix announced Season 4 will premiere in 2020, nothing more specific has been revealed as of this writing.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="ZvZzttnYZKgqCaJZjrQpXV" name="" alt="" src="https://cdn.mos.cms.futurecdn.net/ZvZzttnYZKgqCaJZjrQpXV.jpg" mos="https://cdn.mos.cms.futurecdn.net/ZvZzttnYZKgqCaJZjrQpXV.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="empire-fox">Empire (Fox)</h2><p>At one point a ratings gargantuan, Fox's <em>Empire</em> made completely different kinds of headlines in 2019 thanks to the controversy surrounding <a href="https://www.cinemablend.com/television/2480953/empires-terrence-howard-finally-opens-up-about-his-feelings-related-to-jussie-smollett-jamal-exit" data-original-url="https://www.cinemablend.com/television/2480953/empires-terrence-howard-finally-opens-up-about-his-feelings-related-to-jussie-smollett-jamal-exit">former star Jussie Smollet</a>, but it's back to down-and-dirty basics for the Lyon family as it heads to its <a href="https://www.cinemablend.com/television/2486994/empire-showrunner-talks-midseason-finale-ending-and-when-fans-will-get-answers" data-original-url="https://www.cinemablend.com/television/2486994/empire-showrunner-talks-midseason-finale-ending-and-when-fans-will-get-answers">presumably deadly conclusion</a>.</p><p><strong>When Will Empire End?</strong> Season 6 is set to return to Fox on Wednesday, January 21, though the finale's exact date is not yet known.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="iMqLWvERXD9NPcFH9n4VsZ" name="" alt="fresh off the boat cast" src="https://cdn.mos.cms.futurecdn.net/iMqLWvERXD9NPcFH9n4VsZ.jpg" mos="https://cdn.mos.cms.futurecdn.net/iMqLWvERXD9NPcFH9n4VsZ.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: abc press)</span></figcaption></figure><h2 id="fresh-off-the-boat-abc">Fresh Off The Boat (ABC)</h2><p>Even though <em>Fresh Off the Boat</em> made it to its sixth season, <a href="https://www.cinemablend.com/television/2471621/constance-wu-explains-her-shocking-posts-after-fresh-off-the-boats-renewal" data-original-url="https://www.cinemablend.com/television/2471621/constance-wu-explains-her-shocking-posts-after-fresh-off-the-boats-renewal">despite star Constance Wu's better wishes</a>, ABC <a href="https://www.cinemablend.com/television/2484381/constance-wu-trolled-hard-after-fresh-off-the-boat-cancelled-has-some-defenders" data-original-url="https://www.cinemablend.com/television/2484381/constance-wu-trolled-hard-after-fresh-off-the-boat-cancelled-has-some-defenders">announced in November</a> that the show would be ending in February after 15 episodes.</p><p><strong>When Will Fresh Off the Boat End?</strong> The exact finale date for Season 6 hasn't been announced, but it returns from winter hiatus on January 17.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="DTQZQjd5qCn8MrCzyeTVX8" name="" alt="fuller house stephanie pregnant kimmy d.j. final season" src="https://cdn.mos.cms.futurecdn.net/DTQZQjd5qCn8MrCzyeTVX8.jpg" mos="https://cdn.mos.cms.futurecdn.net/DTQZQjd5qCn8MrCzyeTVX8.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: netflix press)</span></figcaption></figure><h2 id="fuller-house-netflix">Fuller House (Netflix)</h2><p>Netflix found a winner when ordering <em>Full House</em> with the generational continuation <em>Fuller House</em>, but all good-natured things must come to an end, and the Tanner-Fuller-Gibbler families will <a href="https://www.cinemablend.com/television/2484974/fuller-house-is-officially-finished-filming-see-how-netflix-cast-said-goodbye" data-original-url="https://www.cinemablend.com/television/2484974/fuller-house-is-officially-finished-filming-see-how-netflix-cast-said-goodbye">say goodbye in 2020</a>. (Well, <a href="https://www.cinemablend.com/television/2487072/fuller-house-didnt-even-bother-asking-the-olsen-twins-back-for-final-season-5" data-original-url="https://www.cinemablend.com/television/2487072/fuller-house-didnt-even-bother-asking-the-olsen-twins-back-for-final-season-5">everyone but the Olsen twins' Michelle</a>, anyway.)</p><p><strong>When Will Fuller House End?</strong> The second half of Season 5 is set to premiere in 2020, but Netflix has yet to say exactly when.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="Y9dWrKjuE7Bk9L9TobABUH" name="" alt="future man season 2" src="https://cdn.mos.cms.futurecdn.net/Y9dWrKjuE7Bk9L9TobABUH.jpg" mos="https://cdn.mos.cms.futurecdn.net/Y9dWrKjuE7Bk9L9TobABUH.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: hulu press)</span></figcaption></figure><h2 id="future-man-hulu">Future Man (Hulu)</h2><p>One of Hulu's biggest entries in the sci-fi realm, the comedy-driven <em>Future Man</em> put leads Josh Hutcherson and Eliza Coupe though a lot of mind-exploding time travel adventures across its first 26 episodes, and the streaming service announced back in April 2019 that Season 3 would be the final stretch for <em>Future Man</em>'s future...man.</p><p><strong>When Will Future Man End?</strong> Though Season 2 debuted on Hulu back in January 2019, there's no sign just yet when Season 3 will arrive.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="VPnUooLDdvi5PB742d8fcT" name="" alt="season 4 Glow cast" src="https://cdn.mos.cms.futurecdn.net/VPnUooLDdvi5PB742d8fcT.jpg" mos="https://cdn.mos.cms.futurecdn.net/VPnUooLDdvi5PB742d8fcT.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: netflix press)</span></figcaption></figure><h2 id="glow-netflix">GLOW (Netflix)</h2><p>Across its first three seasons, Netflix's <em>GLOW</em> has delivered the kind of sisterhood that no other TV show could possibly match (beyond the vastly different '80s <em>GLOW</em> series), and fans will thankfully get a fourth season to watch Alison Brie, Betty Gilpin and the rest of the talented ensemble find joy in life, whether it be through wrestling fame or through bitching about Mark Maron's Sam.</p><p><strong>When Will GLOW End?</strong> The Season 4 renewal came in September 2019, so it'll likely be later in 2020 when the show returns to Netflix.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="zgSK2YMuXgJNc4xSXp9ufn" name="" alt="goliath billy bob thornton at a bar" src="https://cdn.mos.cms.futurecdn.net/zgSK2YMuXgJNc4xSXp9ufn.png" mos="https://cdn.mos.cms.futurecdn.net/zgSK2YMuXgJNc4xSXp9ufn.png" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: amazon press)</span></figcaption></figure><h2 id="goliath-amazon">Goliath (Amazon)</h2><p>For Season 3, Billy Bob Thornton's crime drama <em>Goliath</em> brought an excellent crop of actors to its already excellent cast – including William Hurt, Beau Bridges, Amy Brenneman and Dennis Quaid – and Amazon followed that season up by ordering the show's fourth and final batch of episodes, which will likely tie up loose ends from previous years while working a new crime into Billy McBride's life.</p><p><strong>When Will Goliath End?</strong> Amazon has yet to reveal any details about when Season 4 will be available to stream.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="A7TCrGqRHXYVYLU8Ct5rDS" name="" alt="good place characters in judgment" src="https://cdn.mos.cms.futurecdn.net/A7TCrGqRHXYVYLU8Ct5rDS.png" mos="https://cdn.mos.cms.futurecdn.net/A7TCrGqRHXYVYLU8Ct5rDS.png" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: nbc press)</span></figcaption></figure><h2 id="the-good-place-nbc">The Good Place (NBC)</h2><p>After multiple afterlives' worth of forking brilliant comedy from Ted Danson, Kristen Bell and the rest of the heavenly cast, <em>The Good Place</em> will hang up its halo (and devil horns) following its fourth season, with creator Michael Schur previously <a href="https://www.cinemablend.com/television/2474998/why-the-good-place-creator-is-ending-the-show-after-season-4" data-original-url="https://www.cinemablend.com/television/2474998/why-the-good-place-creator-is-ending-the-show-after-season-4">setting a plan in place</a> to end the show around the 50-episode mark.</p><p><strong>When Will The Good Place End?</strong> The two-part Season 4 finale is set to air on NBC on Thursday, January 30.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="7UneurdhtaGxHRWiQqTbnX" name="" alt="homeland saul and carrie season 8" src="https://cdn.mos.cms.futurecdn.net/7UneurdhtaGxHRWiQqTbnX.jpg" mos="https://cdn.mos.cms.futurecdn.net/7UneurdhtaGxHRWiQqTbnX.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: showtime press)</span></figcaption></figure><h2 id="homeland-showtime">Homeland (Showtime)</h2><p>Claire Danes' Carrie and Mandy Patinkin's Saul have been through a multitude of hair-raising and politically charged situations across its first seven seasons, and it'll all come to a close with Season 8, though it probably won't be an easy ride for the duo, or anyone else for that matter.</p><p><strong>When Will Season 8 End?</strong> After <a href="https://www.cinemablend.com/television/2477550/why-homelands-final-season-has-been-delayed-until-2020" data-original-url="https://www.cinemablend.com/television/2477550/why-homelands-final-season-has-been-delayed-until-2020">holding off from airing in 2019</a>, <em>Homeland</em> will return to Showtime for its final season on February 9, 2020.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="Q3HzkopBAtJSRekzRLCH6L" name="" alt="how to get away with murder cast" src="https://cdn.mos.cms.futurecdn.net/Q3HzkopBAtJSRekzRLCH6L.jpg" mos="https://cdn.mos.cms.futurecdn.net/Q3HzkopBAtJSRekzRLCH6L.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: abc press)</span></figcaption></figure><h2 id="how-to-get-away-with-murder-abc">How To Get Away With Murder (ABC)</h2><p>Despite maintaining acclaim and goodwill for star Viola Davis, <em>How to Get Away with Murder</em> has seen its audience droop pretty heavily over the years, and ABC decided to pull the plug on the crime drama in July 2019, two months after Season 6 was ordered.</p><p><strong>When Will How to Get Away with Murder End?</strong> The first nine episodes of the sixth and final season have already aired, and ABC announced that Season 6 will debut on April 2 and will close out on May 14.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="ZeiqZ5FWCynadEDN7WsUAh" name="" alt="lucifer smiling" src="https://cdn.mos.cms.futurecdn.net/ZeiqZ5FWCynadEDN7WsUAh.jpg" mos="https://cdn.mos.cms.futurecdn.net/ZeiqZ5FWCynadEDN7WsUAh.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="lucifer-netflix">Lucifer (Netflix)</h2><p>Despite being cancelled at Fox, the devilish drama <em>Lucifer</em> was rescued by Netflix for a fourth season and then rather quickly received its fifth and final season order; obviously getting the show back at all was a huge win for fans, but many think that <em>Lucifer</em>'s heightened popularity on the streaming service should have been rewarded with more seasons. (Especially now that it's <a href="https://www.cinemablend.com/television/2487861/lucifer-is-giving-fans-a-24-reunion-when-god-finally-joins-the-show-in-season-5" data-original-url="https://www.cinemablend.com/television/2487861/lucifer-is-giving-fans-a-24-reunion-when-god-finally-joins-the-show-in-season-5">finally bringing God into the chaos</a>.)</p><p><strong>When Will Lucifer End?</strong> It's not quite clear when <em>Lucifer</em> will return to Netflix for Season 5, but we do know the <a href="https://www.cinemablend.com/television/2487861/lucifer-is-giving-fans-a-24-reunion-when-god-finally-joins-the-show-in-season-5" data-original-url="https://www.cinemablend.com/television/2487861/lucifer-is-giving-fans-a-24-reunion-when-god-finally-joins-the-show-in-season-5">season is being split into two groups</a> of eight episodes, so fans will get a double dose in 2020.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="kbaZz7tBdQ7NLjP45Zvjoi" name="" alt="modern family cast season 10" src="https://cdn.mos.cms.futurecdn.net/kbaZz7tBdQ7NLjP45Zvjoi.jpg" mos="https://cdn.mos.cms.futurecdn.net/kbaZz7tBdQ7NLjP45Zvjoi.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: abc press)</span></figcaption></figure><h2 id="modern-family-abc">Modern Family (ABC)</h2><p>If ABC's <em>Modern Family</em> stayed on the air any longer, it would run the risk of having as many seasons as it does regular cast members, but the creators had other more natural instincts guiding the decision to wrap things up for the Pritchetts, the Dunphys and the Cam with Season 10.</p><p><strong>When Will Modern Family End?</strong> ABC announced that <em>Modern Family</em>'s final episode is set to air on Wednesday, April 8.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="kBEJ5tHHJmcZ7KnKHMjJUR" name="" alt="the 100 characters on world" src="https://cdn.mos.cms.futurecdn.net/kBEJ5tHHJmcZ7KnKHMjJUR.jpg" mos="https://cdn.mos.cms.futurecdn.net/kBEJ5tHHJmcZ7KnKHMjJUR.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: the cw press)</span></figcaption></figure><h2 id="the-100-the-cw">The 100 (The CW)</h2><p>It's almost shocking to think that <em>The 100</em> has been a mainstay at The CW for even longer than <em>The Flash</em> has been, but the youth-oriented adaptation of Kass Morgan's novel series has attracted a fanbase every bit as loyal as those of The CW's other genre offerings. Unfortunately, while no big reasons were given, The CW decided to make Season 7 the final one for Clark & Co., so expect creator Jason Rothenberg to pull out all the stops. </p><p><strong>When Will The 100 End?</strong> The CW hasn't yet announced a premiere or finale date for Season 6, but given <em>The 100</em> has been a summer entry in recent years, it will almost definitely start up around April or May.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="Rn9YqNwvzv6vjFHJ594zb3" name="" alt="power ghost season 6" src="https://cdn.mos.cms.futurecdn.net/Rn9YqNwvzv6vjFHJ594zb3.jpg" mos="https://cdn.mos.cms.futurecdn.net/Rn9YqNwvzv6vjFHJ594zb3.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="power-starz">Power (Starz)</h2><p>Though <em>Power</em> often made headlines because of executive producer and former star 50 Cent's (sometimes scripted) outbursts <a href="https://www.cinemablend.com/television/2471083/powers-50-cent-ends-public-feud-with-co-ep-over-1-million-loan" data-original-url="https://www.cinemablend.com/television/2471083/powers-50-cent-ends-public-feud-with-co-ep-over-1-million-loan">on social media</a>, creator Courtney A. Kemp has consistently kept <em>Power</em> within the upper echelon on TV dramas, and those Ghost's story is closing out with Season 6, Starz is investing in the broader <em>Power</em> universe with <a href="https://www.cinemablend.com/television/2471537/starzs-power-is-ending-with-season-6-but-50-cent-says-dont-trip" data-original-url="https://www.cinemablend.com/television/2471537/starzs-power-is-ending-with-season-6-but-50-cent-says-dont-trip">spinoffs on the way</a>.</p><p><strong>When Will Power End?</strong> The sixth and final season will close out on Sunday, February 9.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="98tKXh3Xxf7LUL5tyYAzen" name="" alt="the rain characters" src="https://cdn.mos.cms.futurecdn.net/98tKXh3Xxf7LUL5tyYAzen.jpg" mos="https://cdn.mos.cms.futurecdn.net/98tKXh3Xxf7LUL5tyYAzen.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: netflix press)</span></figcaption></figure><h2 id="the-rain-netflix">The Rain (Netflix)</h2><p>The Danish post-apocalyptic drama <em>The Rain</em> could probably find way to stretch its survival story out for many seasons, considering how long <em>The Walking Dead</em> is probably going to air, but Netflix decided that three seasons would be the perfect number for Simone, Rasmus and the rest to either find a cure or die trying.</p><p><strong>When Will The Rain End?</strong> Netflix has yet to announce when Season 3 will debut.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="L4j4X2MsABYbu3M29AN4zV" name="" alt="the ranch colt and dad season 4" src="https://cdn.mos.cms.futurecdn.net/L4j4X2MsABYbu3M29AN4zV.jpg" mos="https://cdn.mos.cms.futurecdn.net/L4j4X2MsABYbu3M29AN4zV.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: netflix press)</span></figcaption></figure><h2 id="the-ranch-netflix">The Ranch (Netflix)</h2><p><em>The Ranch</em> is one of those Netflix shows that doesn't inspire a ton of watercooler conversations, but still attracted big enough audiences that the streaming service kept it going for 80 episodes, thanks in part to the popularity of stars Ashton Kutcher, Sam Elliott and Elisha Cuthbert. After detouring around the Danny Masterson controversy, <em>The Ranch</em> set up more potentially deadly mysteries on the way to ending its fourth and final season.</p><p><strong>When Will The Ranch End?</strong> The final batch of episodes will hit Netflix on Friday, January 24.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="irKeiLzNJfY7DdHXCuWw8" name="" alt="" src="https://cdn.mos.cms.futurecdn.net/irKeiLzNJfY7DdHXCuWw8.png" mos="https://cdn.mos.cms.futurecdn.net/irKeiLzNJfY7DdHXCuWw8.png" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="schitt-39-s-creek-pop">Schitt's Creek (Pop)</h2><p>Similarly to how <em>Breaking Bad</em> and more really found their audiences once they debuted on Netflix, the Pop comedy <em>Schitt's Creek</em> won over viewers and the awards circuit with its silliness, its left-field heartfelt moments, and its perfectly cast quartet of Eugene Levy, Catherine O'Hara, Dan Levy and Annie Murphy. The father and son co-creators initially wanted to end <em>Schitt's Creek</em> with Season 5, but settled for one more year when Pop gave the show a two-season renewal after Season 4.</p><p><strong>When Will Schitt's Creek End?</strong> Season 6 debuted on Pop on Tuesday, January 7, though the finale's date still hasn't been determined.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="muuyXNRsaLfJtoSdFcnQha" name="" alt="" src="https://cdn.mos.cms.futurecdn.net/muuyXNRsaLfJtoSdFcnQha.jpg" mos="https://cdn.mos.cms.futurecdn.net/muuyXNRsaLfJtoSdFcnQha.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="the-spanish-princess-starz">The Spanish Princess (Starz)</h2><p>Starz continued its series adaptations of Phillipa Gregory's historical novels (following <em>The White Queen</em> and <em>The White Princess</em>) with <em>The Spanish Princess</em>, and in the middle of the first season's run, the network announced Catherine of Aragon's story would conclude with an eight-episode second season that will no doubt be as gorgeous as the first.</p><p><strong>When Will The Spanish Princess End?</strong> Production on Season 2 started in September 2019, but Starz has yet to alert fans to a release window.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="bvX49JgKPodReKxxDPaVS8" name="" alt="star wars clone wars season 7 obi-wan and anakin" src="https://cdn.mos.cms.futurecdn.net/bvX49JgKPodReKxxDPaVS8.png" mos="https://cdn.mos.cms.futurecdn.net/bvX49JgKPodReKxxDPaVS8.png" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="star-wars-the-clone-wars-disney">Star Wars: The Clone Wars (Disney+)</h2><p>Like other shows on this list, <em>The Clone Wars</em> had already faced a cancellation in past years, and in this case received a <a href="https://www.cinemablend.com/television/2452609/star-wars-the-clone-wars-is-coming-back-heres-what-we-know" data-original-url="https://www.cinemablend.com/television/2452609/star-wars-the-clone-wars-is-coming-back-heres-what-we-know">fairly shocking renewal</a> for a single wrap-up season at Disney+. Considering the <em>Star Wars</em> franchise has <a href="https://www.cinemablend.com/television/2487464/what-the-mandalorians-big-finale-reveal-could-mean-for-season-2-the-clone-wars-revival-and-more" data-original-url="https://www.cinemablend.com/television/2487464/what-the-mandalorians-big-finale-reveal-could-mean-for-season-2-the-clone-wars-revival-and-more">come a long way</a> since <em>Clone Wars</em> originally ended in 2014, fans can't wait to see what Dave Filoni & Co. have in store for Obi-Wan, Anakin, <a href="https://www.cinemablend.com/television/2478586/star-wars-the-clone-wars-ahsoka-looks-ready-to-go-in-disney-premiere-confirmation" data-original-url="https://www.cinemablend.com/television/2478586/star-wars-the-clone-wars-ahsoka-looks-ready-to-go-in-disney-premiere-confirmation">Ahsoka</a> and the rest.</p><p><strong>When Will Star Wars: The Clone Wars End?</strong> Disney+ has yet to go public with a release date, but it'll likely start up in early spring.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="gh4SB2yW4v9WkwXXjDNZBT" name="" alt="strike back wyatt season 6" src="https://cdn.mos.cms.futurecdn.net/gh4SB2yW4v9WkwXXjDNZBT.png" mos="https://cdn.mos.cms.futurecdn.net/gh4SB2yW4v9WkwXXjDNZBT.png" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="strike-back-cinemax">Strike Back (Cinemax)</h2><p>One of the core scripted series that Cinemax will be remembered for, the action-packed <em>Strike Back</em> was given an early renewal for its seventh and final season – its eighth season in the UK, where it airs on original commissioner Sky One – with Warren Brown and Daniel McPherson's Mac and Wyatt closing out Section 20's story for their third years in the roles. (Cinemax's <em>Strike Back</em> originally starred Sullivan Stapleton and Phillip Winchester.)</p><p><strong>When Will Strike Back End?</strong> The seventh and final season will kick off on Cinemax on Friday, February 14.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="dsryXBBFLV7bavXZB4pQC8" name="" alt="supernatural season 15 sam dean castiel" src="https://cdn.mos.cms.futurecdn.net/dsryXBBFLV7bavXZB4pQC8.jpg" mos="https://cdn.mos.cms.futurecdn.net/dsryXBBFLV7bavXZB4pQC8.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="supernatural-the-cw">Supernatural (The CW)</h2><p>No one would have been surprised if <a href="https://www.cinemablend.com/television/How-Long-Supernatural-Continue-According-CW-President-110847.html" data-original-url="https://www.cinemablend.com/television/How-Long-Supernatural-Continue-According-CW-President-110847.html?pv=search"><em>Supernatural</em> stayed on the air</a> until well into the Winchester brothers' golden years, but Jared Padalecki and Jensen Ackles are <a href="https://www.cinemablend.com/television/2478047/misha-collins-says-supernatural-wont-have-a-conventional-happily-ever-after-ending" data-original-url="https://www.cinemablend.com/television/2478047/misha-collins-says-supernatural-wont-have-a-conventional-happily-ever-after-ending">taking down their final monsters</a>, religious icons, and more with Season 15; assuming, of course, that the Impala's door isn't left open for a <a href="https://www.cinemablend.com/television/2477698/working-with-the-supernatural-cast-again-would-be-like-coming-home-for-jensen-ackles" data-original-url="https://www.cinemablend.com/television/2477698/working-with-the-supernatural-cast-again-would-be-like-coming-home-for-jensen-ackles">follow-up adventure or two</a> in the future, since The CW would almost definitely welcome everyone back for more.</p><p><strong>When Will Supernatural End?</strong> The CW hasn't decided exactly when Season 15's finale will air, but the back half of the season will start up on Thursday, January 16.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="RFrTvXVhEHWTNPNYauzpTm" name="" alt="13 reasons why season 3 clay jessica" src="https://cdn.mos.cms.futurecdn.net/RFrTvXVhEHWTNPNYauzpTm.jpg" mos="https://cdn.mos.cms.futurecdn.net/RFrTvXVhEHWTNPNYauzpTm.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="13-reasons-why-netflix">13 Reasons Why (Netflix)</h2><p>Based on the novel by Jay Asher, Netflix's <em>13 Reasons Why</em> bounced between acclaim and controversy during its first three seasons – going so far as to edit out Hannah's suicide scene in Season 1 after facing a long span of complaints – and Netflix set Season 4 to be the last hurrah weeks before Season 3 debuted in August 2019.</p><p><strong>When Will 13 Reasons Why End?</strong> Netflix has yet to announce when Season 4 will debut, but fans should expect it to arrive closer to the end of the year.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="AvrqXEyeWtFe3XktQM3fWY" name="" alt="tim roth in bed tin star amazon season 1" src="https://cdn.mos.cms.futurecdn.net/AvrqXEyeWtFe3XktQM3fWY.png" mos="https://cdn.mos.cms.futurecdn.net/AvrqXEyeWtFe3XktQM3fWY.png" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="tin-star-amazon">Tin Star (Amazon)</h2><p>Tim Roth's Amazon series <em>Tin Star</em> (which is technically an import from the UK's Sky Atlantic) is one that not enough people talk about, but there's still a chance for bigger audiences to get invested by the time the mountain-town crime drama debuts its third and final season.</p><p><strong>When Will Tin Star End?</strong> No details have been given yet for when Season 3 will hit either Sky Atlantic or Amazon.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="CG6Eu6mN9udVEUABXNG63k" name="" alt="netflix trinkets elodie moe and tabitha season 1" src="https://cdn.mos.cms.futurecdn.net/CG6Eu6mN9udVEUABXNG63k.jpg" mos="https://cdn.mos.cms.futurecdn.net/CG6Eu6mN9udVEUABXNG63k.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="trinkets-netflix">Trinkets (Netflix)</h2><p>One of the few youth-skewing projects to get a noteworthy cancellation, the teen drama <em>Trinkets</em> was out there in the world for right around a month and a half before Netflix issued the cancellation notice, which thankfully came with an order Season 2, giving co-creator Kristen "Kiwi" Smith (who also wrote the novel) ten more episodes to wrap up Elodie, Moe and Tabitha's stories.</p><p><strong>When Will Trinkets End?</strong> Netflix has yet to announce any specific release news for Season 2.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="mqB4eFDysCeUHD85NbHpLd" name="" alt="" src="https://cdn.mos.cms.futurecdn.net/mqB4eFDysCeUHD85NbHpLd.png" mos="https://cdn.mos.cms.futurecdn.net/mqB4eFDysCeUHD85NbHpLd.png" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="van-helsing-syfy">Van Helsing (Syfy)</h2><p>Here's hoping Kelly Overton's Vanessa Van Helsing kills off every last vampire in the known universe, because <em>Van Helsing</em> is giving its vocal (if not gigantic) fanbase one more season before putting itself on the stake.</p><p><strong>When Will Van Helsing End?</strong> The fifth and final season is set to go into production in early 2020, with a premiere coming to Syfy at a currently unspecified date.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="2rNNxGBtq3CxQPE3RrE6gH" name="" alt="vikings lagertha bjorn" src="https://cdn.mos.cms.futurecdn.net/2rNNxGBtq3CxQPE3RrE6gH.png" mos="https://cdn.mos.cms.futurecdn.net/2rNNxGBtq3CxQPE3RrE6gH.png" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="vikings-history">Vikings (History)</h2><p>Now in its sixth and final season, <em>Vikings</em> has meshed emotional narratives with historical influences as well as any show before it, and has kept audiences enthralled thanks to the efforts of creator Michael Hirst and a cast currently led by the stellar Katheryn Winnick and Alexander Ludwig. Its split-in-half final season should keep those same audiences going throughout the year, all in anticipation for <a href="https://www.cinemablend.com/television/2486700/vikings-katheryn-winnick-is-all-in-on-being-part-of-the-netflix-spinoff" data-original-url="https://www.cinemablend.com/television/2486700/vikings-katheryn-winnick-is-all-in-on-being-part-of-the-netflix-spinoff">Hirst's Netflix spinoff</a>.</p><p><strong>When Will Vikings End?</strong> Season 6 is currently airing its first ten episodes, with the second batch of ten set to air on History later in 2020.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="xE2mPfT3LEohDiWpNYRRzL" name="" alt="will grace jack and panda costume" src="https://cdn.mos.cms.futurecdn.net/xE2mPfT3LEohDiWpNYRRzL.png" mos="https://cdn.mos.cms.futurecdn.net/xE2mPfT3LEohDiWpNYRRzL.png" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: nbc press)</span></figcaption></figure><h2 id="will-amp-grace-nbc">Will & Grace (NBC)</h2><p>After three seasons back on the air thanks to NBC's later-stage revival, <em>Will & Grace</em> is coming to its second ending at NBC in 2020, though not before its 18-episode final season gives the characters what will undoubtedly be a different resolution than the retconned first finale. (R.I.P. Shelley Morrison and Rosario.)</p><p><strong>When Does Will & Grace End?</strong> Though the latest season was initially meant to slotted for the midseason, it debuted in October and is set to return on Thursday, January 9.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="swBKjtSzbMipwjo36mT8gk" name="" alt="you me her jack emma and izzy season 4" src="https://cdn.mos.cms.futurecdn.net/swBKjtSzbMipwjo36mT8gk.png" mos="https://cdn.mos.cms.futurecdn.net/swBKjtSzbMipwjo36mT8gk.png" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="you-me-her-audience-network">You Me Her (Audience Network)</h2><p>The polyamorous trio at the center of the romantic dramedy <em>You Me Her</em> – Greg Poehler, Rachel Blanchard, and Priscilla Faia – are heading for the final stretch with Season 5, which was initially doubled up with the Season 4 order back in 2018, with Audience Network deciding to pull the plug in the middle of the fourth season's run.</p><p><strong>When Will You Me Her End?</strong> No specific date has been revealed just yet, but past seasons have all released in the late winter or early spring.</p><p>Stay tuned to CinemaBlend to see what other shows are getting the axe throughout 2020, and head to our <a href="https://www.cinemablend.com/television/2484766/2020-winter-and-spring-tv-schedule-premiere-dates-for-network-cable-and-streaming-shows" data-original-url="https://www.cinemablend.com/television/2484766/2020-winter-and-spring-tv-schedule-premiere-dates-for-network-cable-and-streaming-shows">2020 Winter and Spring TV schedule</a> to see everything that's definitely coming back in the near future.</p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ The 16 Most Disappointing TV Cancellations Of 2019 ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/2487671/16-most-disappointing-tv-cancellations-of-2019</link>
                                                                            <description>
                            <![CDATA[ Fans are still feeling the sting of these TV cancellations in the new year. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">hp23BF2AenrEzLj9FdvsDV</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/kgdbJv9rTErFea2zFDWQH-1280-80.png" type="image/png" length="0"></enclosure>
                                                                        <pubDate>Fri, 03 Jan 2020 02:37:45 +0000</pubDate>                                                                                                                                <updated>Tue, 07 Jan 2020 02:11:08 +0000</updated>
                                                                                                                                            <category><![CDATA[Streaming News]]></category>
                                                                                                                    <dc:creator><![CDATA[ Britt Lawrence ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/nZc7U9xPWeMriqycZdeEEo.png ]]></dc:source>
                                                                <dc:description><![CDATA[ null ]]></dc:description>
                                                                                                                                <cf:isSponsored>false</cf:isSponsored>
                <cf:hasAffiliateLinks>false</cf:hasAffiliateLinks>
                <cf:isPaid>false</cf:isPaid>
                                                                                                                                <media:content type="image/png" url="https://cdn.mos.cms.futurecdn.net/kgdbJv9rTErFea2zFDWQH-1280-80.png">
                                                            <media:credit><![CDATA[John P. Fleenor / Netflix]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[Lucifer Tom Ellis Netflix]]></media:description>                                                            <media:text><![CDATA[Lucifer Tom Ellis Netflix]]></media:text>
                                <media:title type="plain"><![CDATA[Lucifer Tom Ellis Netflix]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/kgdbJv9rTErFea2zFDWQH-1280-80.png" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="kgdbJv9rTErFea2zFDWQH" name="" alt="Lucifer Tom Ellis Netflix" src="https://cdn.mos.cms.futurecdn.net/kgdbJv9rTErFea2zFDWQH.png" mos="https://cdn.mos.cms.futurecdn.net/kgdbJv9rTErFea2zFDWQH.png" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: John P. Fleenor / Netflix)</span></figcaption></figure><p>Another year of TV is in the books. Sadly, for some shows, 2019 ended with them not surviving the year. There were a lot of disappointing cancellations that shook and shocked fans. From network television to Netflix’s <a href="https://www.cinemablend.com/television/2475976/all-the-netflix-shows-that-have-been-cancelled-in-2019-so-far" data-original-url="https://www.cinemablend.com/television/2475976/all-the-netflix-shows-that-have-been-cancelled-in-2019-so-far">surprising amount of eliminations</a>, it was a lot to take in.</p><p>It was a tough time to be a freshman series, as well as being a rough year to for Marvel series and spinoffs. From TV shows in the action-adventure wheelhouse to sitcoms and ambitious fantasy shows, none were safe. Without further ado, these were the most disappointing TV cancellations of 2019.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="2wVjRbyExPhBUxyPrRC7oM" name="" alt="Fam Nina Dobrev Clem Tone Bell Nick CBS" src="https://cdn.mos.cms.futurecdn.net/2wVjRbyExPhBUxyPrRC7oM.png" mos="https://cdn.mos.cms.futurecdn.net/2wVjRbyExPhBUxyPrRC7oM.png" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: CBS)</span></figcaption></figure><h2 id="fam">Fam</h2><p>Things were cleared in Nina Dobrev’s schedule for <a href="https://www.cinemablend.com/television/2463646/will-the-vampire-diaries-elena-ever-be-on-legacies-nina-dobrevs-new-show-competes-with-it" data-original-url="https://www.cinemablend.com/television/2463646/will-the-vampire-diaries-elena-ever-be-on-legacies-nina-dobrevs-new-show-competes-with-it">a potential return</a> to <em>The Vampire Diaries</em>’ universe early in 2019. Unfortunately for CBS’ <em>Fam</em>, the actress’ return to television ended up being short-lived. Dobrev <a href="https://www.cinemablend.com/television/2465500/nina-dobrev-had-an-anxiety-attack-filming-the-fam-premiere" data-original-url="https://www.cinemablend.com/television/2465500/nina-dobrev-had-an-anxiety-attack-filming-the-fam-premiere">weathered an anxiety attack</a> to do <em>Fam</em>, only to have it get cancelled in the notoriously brutal month of May. Since the cancellation, though, Dobrev has landed <a href="https://www.cinemablend.com/television/2477062/what-vampire-diaries-nina-dobrev-is-doing-next-after-cbs-fam" data-original-url="https://www.cinemablend.com/television/2477062/what-vampire-diaries-nina-dobrev-is-doing-next-after-cbs-fam">a new project</a>.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="q4LSQTLYYgX7qicaQrcFs8" name="" alt="Whiskey Cavalier Lauren Cohan Francesca Frankie Trowbridge ABC" src="https://cdn.mos.cms.futurecdn.net/q4LSQTLYYgX7qicaQrcFs8.png" mos="https://cdn.mos.cms.futurecdn.net/q4LSQTLYYgX7qicaQrcFs8.png" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: Nick Ray / ABC)</span></figcaption></figure><h2 id="whiskey-cavalier">Whiskey Cavalier</h2><p>Fans had to raise a glass and pour one out for <em>Whiskey Cavalier</em>, as ABC decided to cancel the series, starring <em>The Walking Dead</em>’s Lauren Cohan and <em>Scandal</em>’s Scott Foley. Despite a <a href="https://www.cinemablend.com/television/2472182/whoa-is-whiskey-cavalier-getting-renewed-for-season-2-at-abc-even-after-its-cancellation" data-original-url="https://www.cinemablend.com/television/2472182/whoa-is-whiskey-cavalier-getting-renewed-for-season-2-at-abc-even-after-its-cancellation">brief hint of hope</a> regarding its future, the cancellation <a href="https://www.cinemablend.com/television/2472246/whiskey-cavalier-has-been-fully-and-finally-cancelled-again-by-abc" data-original-url="https://www.cinemablend.com/television/2472246/whiskey-cavalier-has-been-fully-and-finally-cancelled-again-by-abc">ended up going through</a>. While disappointing for fans, it paved the way for Cohan <a href="https://www.cinemablend.com/television/2483408/wait-is-lauren-cohans-maggie-returning-to-the-walking-dead-way-earlier-than-expected" data-original-url="https://www.cinemablend.com/television/2483408/wait-is-lauren-cohans-maggie-returning-to-the-walking-dead-way-earlier-than-expected">to return to</a> the AMC zombie drama.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="Jv8JeQ89qjKHpF7Anx44Mo" name="" alt="Lethal Weapon Damon Wayans Roger Murtaugh Seann William Scott Wesley Cole FOX" src="https://cdn.mos.cms.futurecdn.net/Jv8JeQ89qjKHpF7Anx44Mo.png" mos="https://cdn.mos.cms.futurecdn.net/Jv8JeQ89qjKHpF7Anx44Mo.png" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: Ray Mickshaw / FOX)</span></figcaption></figure><h2 id="lethal-weapon">Lethal Weapon</h2><p>The TV adaptation of the beloved movie franchise went through a lot during its three seasons on the air. After <a href="https://www.cinemablend.com/television/2460439/how-lethal-weapon-changed-with-cole-instead-of-riggs" data-original-url="https://www.cinemablend.com/television/2460439/how-lethal-weapon-changed-with-cole-instead-of-riggs">a casting shakeup</a> that saw Sean William Scott join the show and Damon Wayans, at one point, <a href="https://www.cinemablend.com/television/2466590/what-was-really-going-on-with-damon-wayans-when-he-threatened-to-quit-lethal-weapon" data-original-url="https://www.cinemablend.com/television/2466590/what-was-really-going-on-with-damon-wayans-when-he-threatened-to-quit-lethal-weapon">indicate plans to exit</a>, <em>Lethal Weapon</em> set itself up for <a href="https://www.cinemablend.com/television/2467537/lethal-weapons-crazy-season-3-finale-twist-could-set-up-a-totally-different-season-4" data-original-url="https://www.cinemablend.com/television/2467537/lethal-weapons-crazy-season-3-finale-twist-could-set-up-a-totally-different-season-4">a potential fourth season</a>. Disappointingly, fans will never get to see that setup pay off.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="PWVY8cr9jZhQkvj6sNpKSK" name="" alt="Pearson Gina Torres Jessica Pearson USA" src="https://cdn.mos.cms.futurecdn.net/PWVY8cr9jZhQkvj6sNpKSK.png" mos="https://cdn.mos.cms.futurecdn.net/PWVY8cr9jZhQkvj6sNpKSK.png" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: Isabella Vosmikova / USA Network)</span></figcaption></figure><h2 id="pearson">Pearson</h2><p><em>Suits</em> ended its long run without Meghan Markle but with the hope of a hit spinoff in the Gina Torres-led, <em>Pearson</em>. After a considerable wait, the series finally debuted in 2019. Following a single season, USA <a href="https://www.cinemablend.com/television/2483665/gina-torres-pearson-cancelled-after-one-season-at-usa-so-is-suits-done-for-good" data-original-url="https://www.cinemablend.com/television/2483665/gina-torres-pearson-cancelled-after-one-season-at-usa-so-is-suits-done-for-good">cancelled the much-anticipated</a> legal drama, in a move that now leaves TV without a show in <a href="https://www.cinemablend.com/television/2475780/usas-pearson-will-other-suits-characters-join-gina-torres-spinoff" data-original-url="https://www.cinemablend.com/television/2475780/usas-pearson-will-other-suits-characters-join-gina-torres-spinoff">the <em>Suits</em> universe</a>.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="m7gQXMTDKrfEVLSpKpvR75" name="" alt="Marvel's Cloak and Dagger Olivia Holt Tandy Bowen Dagger Aubrey Joseph Tyrone Johnson Cloak Freeform" src="https://cdn.mos.cms.futurecdn.net/m7gQXMTDKrfEVLSpKpvR75.png" mos="https://cdn.mos.cms.futurecdn.net/m7gQXMTDKrfEVLSpKpvR75.png" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: Alfonso Bresciani / Freeform)</span></figcaption></figure><h2 id="marvel-s-cloak-and-dagger">Marvel’s Cloak and Dagger</h2><p>As previously mentioned, 2019 was <a href="https://www.cinemablend.com/television/2482839/things-arent-looking-good-for-marvel-tv-outside-of-the-mcu-shows" data-original-url="https://www.cinemablend.com/television/2482839/things-arent-looking-good-for-marvel-tv-outside-of-the-mcu-shows">not a great year</a> to be a Marvel series. After two seasons on Freeform, <em>Marvel’s Cloak and Dagger</em> joined the <a href="https://www.cinemablend.com/television/2483128/marvels-cloak-and-dagger-cancelled-after-two-seasons-but-what-about-runaways" data-original-url="https://www.cinemablend.com/television/2483128/marvels-cloak-and-dagger-cancelled-after-two-seasons-but-what-about-runaways">slew of cancellations</a> to befall the Marvel Universe TV landscape. Adding to the disappointment was that the decision came as anticipation was mounting for the characters' exciting crossover with Hulu’s <em>Runaways</em> (which was later cancelled itself).</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="KGUtZPxhGWrjRd5hhhtHtR" name="" alt="Pretty Little Liars Mona Vanderwaal Janel Parrish Freeform" src="https://cdn.mos.cms.futurecdn.net/KGUtZPxhGWrjRd5hhhtHtR.png" mos="https://cdn.mos.cms.futurecdn.net/KGUtZPxhGWrjRd5hhhtHtR.png" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: Allyson Riggs / Freeform)</span></figcaption></figure><h2 id="pretty-little-liars-the-perfectionists">Pretty Little Liars: The Perfectionists</h2><p>Fans hoping for the stars of <em>Pretty Little Liars</em> to get involved with the long-running drama’s spinoff quickly became disappointed. Following one season, <em>The Perfectionists</em> got cancelled to <a href="https://www.cinemablend.com/television/2481204/angry-pretty-little-liars-fans-blast-freeform-for-cancelling-the-perfectionists" data-original-url="https://www.cinemablend.com/television/2481204/angry-pretty-little-liars-fans-blast-freeform-for-cancelling-the-perfectionists">many fans’ chagrin</a>. During its short time on the air, the spinoff provided a <a href="https://www.cinemablend.com/television/2470142/the-perfectionists-just-revealed-the-fate-of-one-pretty-little-liars-couple" data-original-url="https://www.cinemablend.com/television/2470142/the-perfectionists-just-revealed-the-fate-of-one-pretty-little-liars-couple">sad relationship update</a>, a happy one, thrilling baby news, and the answer to <a href="https://www.cinemablend.com/television/2470597/how-the-pretty-little-liars-spinoff-finally-addressed-alex-and-mary-drake" data-original-url="https://www.cinemablend.com/television/2470597/how-the-pretty-little-liars-spinoff-finally-addressed-alex-and-mary-drake">a dangling plot thread</a>. Silver lining?</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="LiwXABdkT8RapnNawLtF2W" name="" alt="Jessica Jones Rachael Taylor Patricia Trish Walker Krysten Ritter Jessica Jones Netflix" src="https://cdn.mos.cms.futurecdn.net/LiwXABdkT8RapnNawLtF2W.png" mos="https://cdn.mos.cms.futurecdn.net/LiwXABdkT8RapnNawLtF2W.png" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="jessica-jones">Jessica Jones</h2><p>The one-time Defender was gearing up to return for Season 3 when Netflix announced <a href="https://www.cinemablend.com/television/2467089/jessica-jones-and-the-punisher-cancelled-at-netflix" data-original-url="https://www.cinemablend.com/television/2467089/jessica-jones-and-the-punisher-cancelled-at-netflix">it had cancelled</a> <em>Jessica Jones</em>. Making the superhero drama’s third season the show's last. Krysten Ritter <a href="https://www.cinemablend.com/television/2475472/jessica-jones-krysten-ritter-doesnt-sound-very-interested-in-returning-to-the-mcu" data-original-url="https://www.cinemablend.com/television/2475472/jessica-jones-krysten-ritter-doesnt-sound-very-interested-in-returning-to-the-mcu">may not be interested</a> in reprising her run as the title character in the MCU. As fans await word on Jones and <a href="https://www.cinemablend.com/news/2475928/will-we-see-any-marvel-netflix-heroes-in-an-mcu-movie-heres-what-kevin-feige-says" data-original-url="https://www.cinemablend.com/news/2475928/will-we-see-any-marvel-netflix-heroes-in-an-mcu-movie-heres-what-kevin-feige-says">other characters’ futures</a>, TV is undoubtedly down a superheroine.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="N2DmqTXxe5mjAxdNSaW3b5" name="" alt="The Punisher Karen Page Deborah Ann Woll Frank Castle Jon Bernthal Netflix" src="https://cdn.mos.cms.futurecdn.net/N2DmqTXxe5mjAxdNSaW3b5.png" mos="https://cdn.mos.cms.futurecdn.net/N2DmqTXxe5mjAxdNSaW3b5.png" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: Cara Howe / Netflix)</span></figcaption></figure><h2 id="the-punisher">The Punisher</h2><p>While expected, considering the trend that started, <em>The Punisher</em>’s <a href="https://www.cinemablend.com/television/2467100/jon-bernthal-and-krysten-ritter-react-to-the-punisher-and-jessica-jones-cancellations" data-original-url="https://www.cinemablend.com/television/2467100/jon-bernthal-and-krysten-ritter-react-to-the-punisher-and-jessica-jones-cancellations">cancellation</a> was still a huge gut punch. Fans of the Netflix show will never get to see what <a href="https://www.cinemablend.com/television/2465933/the-punishers-jon-bernthal-wants-to-see-more-from-frank-and-karen" data-original-url="https://www.cinemablend.com/television/2465933/the-punishers-jon-bernthal-wants-to-see-more-from-frank-and-karen">would have become</a> of Frank Castle and Karen Page’s sizzling chemistry. Mercifully, <a href="https://www.cinemablend.com/television/2465527/how-the-punishers-jon-bernthal-and-giorgia-whigham-view-the-season-2-ending" data-original-url="https://www.cinemablend.com/television/2465527/how-the-punishers-jon-bernthal-and-giorgia-whigham-view-the-season-2-ending">the ending of Season 2</a> did not leave viewers with many other loose ends. That would have been an unmerited punishment.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="t9Gev2t6szRH6rvNEpjR7W" name="" alt="Santa Clarita Diet Liv Hewson Abby Hammond Drew Barrymore Sheila Hammond Timothy Olyphant Joel Hammo" src="https://cdn.mos.cms.futurecdn.net/t9Gev2t6szRH6rvNEpjR7W.png" mos="https://cdn.mos.cms.futurecdn.net/t9Gev2t6szRH6rvNEpjR7W.png" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: Saeed Adyani / Netflix)</span></figcaption></figure><h2 id="santa-clarita-diet">Santa Clarita Diet</h2><p>Drew Barrymore and Timothy Olyphant’s dark comedy about a zombie mom living in suburbia was a fan-favorite among Netflix users. No matter <a href="https://www.cinemablend.com/television/2487346/the-10-best-netflix-original-tv-shows-of-2019" data-original-url="https://www.cinemablend.com/television/2487346/the-10-best-netflix-original-tv-shows-of-2019">how beloved it was</a>, the streaming giant still <a href="https://www.cinemablend.com/television/2470923/netflix-cancelled-santa-clarita-diet-and-timothy-olyphant-had-the-perfect-response" data-original-url="https://www.cinemablend.com/television/2470923/netflix-cancelled-santa-clarita-diet-and-timothy-olyphant-had-the-perfect-response">decided to cancel</a> <em>Santa Clarita Diet</em> after three seasons. So long, <a href="https://www.cinemablend.com/television/2469227/how-santa-clarita-diet-season-3-set-joel-and-sheilas-story-up-for-possible-season-4" data-original-url="https://www.cinemablend.com/television/2469227/how-santa-clarita-diet-season-3-set-joel-and-sheilas-story-up-for-possible-season-4">potential Season 4 storylines</a>! The cast may be moving on, but fans are no less engulfed in disappointment over the cancellation.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="9iQ6MCczLExr6u8zuFijxi" name="" alt="Lucifer Eve Inbar Lavi Tom Ellis Netflix" src="https://cdn.mos.cms.futurecdn.net/9iQ6MCczLExr6u8zuFijxi.png" mos="https://cdn.mos.cms.futurecdn.net/9iQ6MCczLExr6u8zuFijxi.png" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: John P. Fleenor / Netflix)</span></figcaption></figure><h2 id="lucifer">Lucifer</h2><p>Fans of the Fox-turned-Netflix series fought very hard to get another season of the supernatural drama. Following <a href="https://www.cinemablend.com/television/2474883/lucifer-season-4-is-reportedly-crushing-in-binge-views-on-netflix" data-original-url="https://www.cinemablend.com/television/2474883/lucifer-season-4-is-reportedly-crushing-in-binge-views-on-netflix">a successful Season 4</a>, <em>Lucifer</em> fans got the shocking and disappointing news that Season 5 <a href="https://www.cinemablend.com/television/2474539/lucifers-tom-ellis-will-see-fans-in-hell-for-fifth-and-final-season-on-netflix" data-original-url="https://www.cinemablend.com/television/2474539/lucifers-tom-ellis-will-see-fans-in-hell-for-fifth-and-final-season-on-netflix">would be the show's last</a>. A petition for another season was quickly circulated with the co-showrunner <a href="https://www.cinemablend.com/television/2475132/how-lucifers-showrunner-feels-about-fans-petitioning-for-season-6-after-netflix-cancellation" data-original-url="https://www.cinemablend.com/television/2475132/how-lucifers-showrunner-feels-about-fans-petitioning-for-season-6-after-netflix-cancellation">weighing in on</a> the development. Regardless, a <a href="https://www.cinemablend.com/television/2477174/lucifers-final-season-just-got-a-lot-bigger-at-netflix" data-original-url="https://www.cinemablend.com/television/2477174/lucifers-final-season-just-got-a-lot-bigger-at-netflix">super-sized final season</a> is on its way.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="zcTwN3VsxgvvAG8jfPinrm" name="" alt="The OA Brit Marling Prairie Johnson Nina Azarova Kingsley Ben-Adir Karim Washington Netflix" src="https://cdn.mos.cms.futurecdn.net/zcTwN3VsxgvvAG8jfPinrm.png" mos="https://cdn.mos.cms.futurecdn.net/zcTwN3VsxgvvAG8jfPinrm.png" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: Olivia Bee / Netflix)</span></figcaption></figure><h2 id="the-oa">The OA</h2><p>Despite <a href="https://www.cinemablend.com/television/2469009/the-oa-season-2-finale-broke-all-the-rules-and-im-exhausted" data-original-url="https://www.cinemablend.com/television/2469009/the-oa-season-2-finale-broke-all-the-rules-and-im-exhausted">a shocking Season 2 finale</a>, Netflix decided <em>The OA</em> would not continue to unravel its many implications. The streaming giant cancelled the sci-fi fantasy drama in August. While a fan theory <a href="https://www.cinemablend.com/television/2477890/why-the-oa-cancellation-might-be-a-fake-according-to-one-theory" data-original-url="https://www.cinemablend.com/television/2477890/why-the-oa-cancellation-might-be-a-fake-according-to-one-theory">hoped it was a fake-out</a>, months have passed without that positive turnaround. Fan outrage has followed, and protests have been had, but there will <a href="https://www.cinemablend.com/television/2478869/the-oa-wont-be-getting-a-series-finale-movie-at-netflix" data-original-url="https://www.cinemablend.com/television/2478869/the-oa-wont-be-getting-a-series-finale-movie-at-netflix">not be a follow-up movie</a>.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="UbWKSDxVYZ2WK8xF4wXt6A" name="" alt="BoJack Horseman Netflix" src="https://cdn.mos.cms.futurecdn.net/UbWKSDxVYZ2WK8xF4wXt6A.png" mos="https://cdn.mos.cms.futurecdn.net/UbWKSDxVYZ2WK8xF4wXt6A.png" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="bojack-horseman-5">BoJack Horseman</h2><p>In a super-surprising 2019 development, Netflix announced that the beloved animated adult series, <em>BoJack Horseman</em>, would end with Season 6. Star Aaron Paul subsequently spoke out with <a href="https://www.cinemablend.com/television/2481223/why-is-netflixs-bojack-horseman-ending-aaron-paul-seems-to-have-a-different-explanation" data-original-url="https://www.cinemablend.com/television/2481223/why-is-netflixs-bojack-horseman-ending-aaron-paul-seems-to-have-a-different-explanation">a different explanation</a> for the show ending. Whatever the cause, <em>BoJack Horseman</em>’s creator talked openly about Netflix’s <a href="https://www.cinemablend.com/television/2483868/bojack-horsemans-creator-thinks-its-a-shame-that-netflix-changed-its-cancellation-policy" data-original-url="https://www.cinemablend.com/television/2483868/bojack-horsemans-creator-thinks-its-a-shame-that-netflix-changed-its-cancellation-policy">changing cancellation policy</a>, as <em>BoJack Horseman</em> readies to say goodbye.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="q2RwB7KZcPCxWSWAcUyMfc" name="" alt="Fuller House Stephanie Tanner Jodie Sweetin DJ Tanner-Fuller Candace Cameron Bure Netflix" src="https://cdn.mos.cms.futurecdn.net/q2RwB7KZcPCxWSWAcUyMfc.png" mos="https://cdn.mos.cms.futurecdn.net/q2RwB7KZcPCxWSWAcUyMfc.png" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: Michael Yarish / Netflix)</span></figcaption></figure><h2 id="fuller-house">Fuller House</h2><p>So much for Kevin Costner or the <a href="https://www.cinemablend.com/television/2487072/fuller-house-didnt-even-bother-asking-the-olsen-twins-back-for-final-season-5" data-original-url="https://www.cinemablend.com/television/2487072/fuller-house-didnt-even-bother-asking-the-olsen-twins-back-for-final-season-5">Olsen twins stopping by</a> <em>Fuller House</em>. After some disconcerting rumblings and <a href="https://www.cinemablend.com/television/2459769/fuller-houses-candace-cameron-bure-is-shutting-down-those-cancellation-rumors" data-original-url="https://www.cinemablend.com/television/2459769/fuller-houses-candace-cameron-bure-is-shutting-down-those-cancellation-rumors">shut down rumors</a>, Netflix announced Season 5 would be <em>Fuller House</em>’s last. Cue cast reactions and the emotional <a href="https://www.cinemablend.com/television/2484974/fuller-house-is-officially-finished-filming-see-how-netflix-cast-said-goodbye" data-original-url="https://www.cinemablend.com/television/2484974/fuller-house-is-officially-finished-filming-see-how-netflix-cast-said-goodbye">final day of filming</a>. “Cut it out” Netflix! The <a href="https://www.cinemablend.com/television/2486102/fuller-house-star-teases-old-familiar-faces-returning-for-final-episodes-but-who" data-original-url="https://www.cinemablend.com/television/2486102/fuller-house-star-teases-old-familiar-faces-returning-for-final-episodes-but-who">second half of Season 5 awaits,</a> with some wedding bells ringing to brighten fans’ spirits.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="qQQrNowv79mnNtZZAzsNWM" name="" alt="Counterpart J.K. Simmons Howard Silk Starz" src="https://cdn.mos.cms.futurecdn.net/qQQrNowv79mnNtZZAzsNWM.png" mos="https://cdn.mos.cms.futurecdn.net/qQQrNowv79mnNtZZAzsNWM.png" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: Starz)</span></figcaption></figure><h2 id="counterpart">Counterpart</h2><p>Academy Award winner and proverbial scene-stealer (in my opinion), J.K. Simmons <a href="https://www.cinemablend.com/television/1721440/jk-simmons-looks-fantastic-in-dual-roles-for-starzs-crazy-crime-thriller-counterpart" data-original-url="https://www.cinemablend.com/television/1721440/jk-simmons-looks-fantastic-in-dual-roles-for-starzs-crazy-crime-thriller-counterpart">came to television</a> with Starz’s dramatic sci-fi thriller, <em>Counterpart</em>. <a href="https://www.cinemablend.com/television/2382512/counterpart-just-revealed-clares-crazy-backstory-heres-what-the-actress-told-us" data-original-url="https://www.cinemablend.com/television/2382512/counterpart-just-revealed-clares-crazy-backstory-heres-what-the-actress-told-us">Crazy reveals</a>, and Simmons’s dual roles were not enough to get the series renewed for Season 3. In the end, the acclaimed show was cancelled for <a href="https://www.cinemablend.com/television/2477496/jk-simmons-counterpart-was-cancelled-at-starz-for-being-too-male" data-original-url="https://www.cinemablend.com/television/2477496/jk-simmons-counterpart-was-cancelled-at-starz-for-being-too-male">being a “very male show"</a> which, supposedly, didn't fit Starz’s female-driven strategy.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="PZ5y2fvTkgUFon7y79jb3U" name="" alt="The Passage Mark-Paul Gosselaar Brad Wolgast Saniyya Sidney Amy Bellafonte Fox" src="https://cdn.mos.cms.futurecdn.net/PZ5y2fvTkgUFon7y79jb3U.png" mos="https://cdn.mos.cms.futurecdn.net/PZ5y2fvTkgUFon7y79jb3U.png" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: FOX)</span></figcaption></figure><h2 id="the-passage">The Passage</h2><p>People were warned, but it still did not help Fox’s dramatic thriller, <em>The Passage</em>, stick around. The TV adaptation was <a href="https://www.cinemablend.com/television/2471603/all-the-big-tv-cancellations-that-just-went-down" data-original-url="https://www.cinemablend.com/television/2471603/all-the-big-tv-cancellations-that-just-went-down">cancelled by Fox</a> after a single season, meaning that Mark-Paul Gosselaar’s concerns that <em>The Passage</em> would share the single-season outcome of <em>Pitch</em> came true, which was a sad recurrence. Gosselaar did land back on TV via ABC’s <em>mixed-ish</em>, but no <em>Saved by the Bell</em> <a href="https://www.cinemablend.com/television/2480618/an-update-on-why-saved-by-the-bell-didnt-call-mark-paul-gosselaar-for-the-reboot" data-original-url="https://www.cinemablend.com/television/2480618/an-update-on-why-saved-by-the-bell-didnt-call-mark-paul-gosselaar-for-the-reboot">reboot for him just yet</a>.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="bJ9X8HZg57X8PivJysfKhd" name="" alt="Legion Dan Stevens David Haller FX" src="https://cdn.mos.cms.futurecdn.net/bJ9X8HZg57X8PivJysfKhd.png" mos="https://cdn.mos.cms.futurecdn.net/bJ9X8HZg57X8PivJysfKhd.png" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: Suzanne Tenner / FX)</span></figcaption></figure><h2 id="legion">Legion</h2><p>Noah Hawley’s ambitious superhero drama got renewed for Season 3 back in 2018. Fast forward to 2019, and Hawley explained why <em>Legion</em> <a href="https://www.cinemablend.com/television/2466380/why-legion-is-ending-after-season-3" data-original-url="https://www.cinemablend.com/television/2466380/why-legion-is-ending-after-season-3">would be ending</a> with that third season. The show finished its run in the summer of 2019, but, thankfully for fans, <em>Legion</em>’s final season saw the <a href="https://www.cinemablend.com/television/2471419/legion-season-3-trailer-finally-embraces-x-men-with-professor-x-and-cerebro-first-looks" data-original-url="https://www.cinemablend.com/television/2471419/legion-season-3-trailer-finally-embraces-x-men-with-professor-x-and-cerebro-first-looks">introduction of Professor X</a> and a series finale that may have <a href="https://www.cinemablend.com/television/2478046/legion-season-3-series-finale-explained" data-original-url="https://www.cinemablend.com/television/2478046/legion-season-3-series-finale-explained">needed some explaining</a>.</p><p>All of these might not be disappointing for you, but many fans certainly felt the anguish of these cancellations. But, television is known for its highs and its lows. The month of May will be here before you know it, which means more shows will undoubtedly join 2019’s cancellations in television's great beyond. The medium continues making new strides, but the stinging disappointment of <a href="https://www.cinemablend.com/television/2484299/all-the-tv-shows-that-have-already-been-cancelled-in-fall-2019" data-original-url="https://www.cinemablend.com/television/2484299/all-the-tv-shows-that-have-already-been-cancelled-in-fall-2019">TV cut short</a> still burns.</p><p>While television fans continue to mourn the disappointing cancellations of 2019, they have a lot to look forward to in 2020. <a href="https://www.netflix.com/browse">Netflix</a> has <a href="https://www.cinemablend.com/television/2485936/2020-netflix-schedule-premiere-dates-for-new-and-returning-shows" data-original-url="https://www.cinemablend.com/television/2485936/2020-netflix-schedule-premiere-dates-for-new-and-returning-shows">tons of new content</a> coming this year. If that is not enough, <a href="https://www.cinemablend.com/television/2484766/2020-winter-and-spring-tv-schedule-premiere-dates-for-network-cable-and-streaming-shows" data-original-url="https://www.cinemablend.com/television/2484766/2020-winter-and-spring-tv-schedule-premiere-dates-for-network-cable-and-streaming-shows">this winter’s premieres</a> are not cold comfort.</p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ BoJack Horseman Creator Has Some Blunt Thoughts About One Of Netflix's Practices ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/2487509/bojack-horseman-creator-has-some-blunt-thoughts-about-one-of-netflix-practices</link>
                                                                            <description>
                            <![CDATA[ Raphael Bob-Waksberg has some beef with Netflix and other streaming services. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">5e1A1DJdXMMoCS4b6Bd5ZB</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/FJqk4eJur8N2UiqtEQS5DG-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Sat, 28 Dec 2019 20:20:48 +0000</pubDate>                                                                                                                                                                                                                                <category><![CDATA[Streaming News]]></category>
                                                                                                <author><![CDATA[ mick.joest@CinemaBlend.com (Mick Joest) ]]></author>                    <dc:creator><![CDATA[ Mick Joest ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/4dnBaqggYBopRBZtr5dHzg.png ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Mick Joest is a Content Producer for CinemaBlend with his hand in an eclectic mix of television goodness. Star Trek is his main jam, but he also regularly reports on happenings in the world of Star Trek, WWE, Doctor Who, 90 Day Fiancé, Quantum Leap, and Big Brother. He graduated from the University of Southern Indiana with a degree in Journalism and a minor in Radio and Television. He&#039;s great at hosting panels and appearing on podcasts if given the chance as well.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What He&#039;s Into&lt;/strong&gt;: Most everything Mick reports on because he&#039;s passionate and a fan of the subject. He really loves interviewing people and getting the bigger answers to questions. Outside of work, he&#039;s a sports fan who supports the Indiana Pacers, as well as the New England Patriots.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What He&#039;s Excited About Right Now&lt;/strong&gt;: Mick is excited for the tentative ending of the writer&#039;s strike and for more of his favorite shows like Quantum Leap and Star Trek: Strange New Worlds to finish out their in-development seasons.&amp;nbsp;&lt;/p&gt; ]]></dc:description>
                                                                                                                                <cf:isSponsored>false</cf:isSponsored>
                <cf:hasAffiliateLinks>false</cf:hasAffiliateLinks>
                <cf:isPaid>false</cf:isPaid>
                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/FJqk4eJur8N2UiqtEQS5DG-1280-80.jpg">
                                                            <media:credit><![CDATA[null]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[BoJack Horseman Netflix]]></media:description>                                                            <media:text><![CDATA[BoJack Horseman Netflix]]></media:text>
                                <media:title type="plain"><![CDATA[BoJack Horseman Netflix]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/FJqk4eJur8N2UiqtEQS5DG-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>Raphael Bob-Waksberg is responsible for one of Netflix's <a href="https://www.cinemablend.com/television/2486865/12-terrific-shows-coming-to-netflix-in-january-2020" data-original-url="https://www.cinemablend.com/television/2486865/12-terrific-shows-coming-to-netflix-in-january-2020">most notable originals</a> and one of Amazon's <a href="https://www.cinemablend.com/television/2487473/the-6-best-new-streaming-shows-of-2019" data-original-url="https://www.cinemablend.com/television/2487473/the-6-best-new-streaming-shows-of-2019">best new originals</a>, so he knows a bit about the streaming experience. Bob-Wakberg has been candid about the things <a href="https://www.cinemablend.com/television/2487499/why-so-many-people-spent-christmas-trying-to-cancel-netflix" data-original-url="https://www.cinemablend.com/television/2487499/why-so-many-people-spent-christmas-trying-to-cancel-netflix">he doesn't like</a> about Netflix's new policies on cancellation, and now he's taking aim at something almost all streaming services are guilty of to some degree -- credit skipping.</p><p>Bob-Waksberg posted on <a href="https://twitter.com/RaphaelBW">Twitter</a> in regard to another user's complaints about skipping credits, and had some thoughts of his own. As the creator of <em>BoJack Horseman</em> and other streaming shows, obviously he has a dog in the fight in this discussion.</p><div class="see-more see-more--clipped"><blockquote class="twitter-tweet hawk-ignore" data-lang="en"><p lang="en" dir="ltr"><a href="https://twitter.com/cantworkitout/status/1209368731349991424"></a></p></blockquote><div class="see-more__filter"></div></div><p>Credits are meant to acknowledge the hard work of the people that created a show or movie. At one point, a majority of names were listed at the start of a movie, but over time, credits shifted to the end of the movie.Now we're in an era of streaming where Netflix and others are flat out auto-scrolling audiences to the next episode before the credits complete.</p><p>In fairness, it's probably not a problem for most streaming subscribers, though the auto-start through credits has negatively impacted some viewing experiences. Raphael Bob-Waksberg specifically called out Amazon Prime in an example of that, as a <a href="https://www.cinemablend.com/television/2474596/bojack-horseman-creators-new-amazon-show-undone-looks-like-nothing-else-on-tv" data-original-url="https://www.cinemablend.com/television/2474596/bojack-horseman-creators-new-amazon-show-undone-looks-like-nothing-else-on-tv">viewing of <em>Undone</em></a> was interrupted by a "next episode" prompt before the credits even rolled.</p><div class="see-more see-more--clipped"><blockquote class="twitter-tweet hawk-ignore" data-lang="en"><p lang="en" dir="ltr"><a href="https://twitter.com/cantworkitout/status/1209369605426171904"></a></p></blockquote><div class="see-more__filter"></div></div><p>Not all shows will be as negatively impacted as that episode of <em>Undone</em>, though that instance shows part of the problem. Some shows or movies offer a post-credits sequence, and Netflix and others may not account for that and skip ahead to the next thing in an effort to keep its subscribers bingeing on to the next thing.</p><p>While Raphael Bob-Waksberg had plenty of supporters replying to his tweet, there were some who disagreed. When one person remarked they don't think television credits are as respectful of people's time when compared to movie credits, Bob-Waksberg clarified and said his problem isn't that people are skipping credits, but that they don't really have a choice in some cases one way or another.</p><div class="see-more see-more--clipped"><blockquote class="twitter-tweet hawk-ignore" data-lang="en"><p lang="en" dir="ltr"><a href="https://twitter.com/cantworkitout/status/1209379242980429825"></a></p></blockquote><div class="see-more__filter"></div></div><p>Raphael Bob-Waksberg makes a good point, though it isn't surprising to see this take after some of the problems he's had with streaming services in 2019. Netflix cancelled the BoJack Horseman spinoff <em>Tuca & Bertie</em>, and there's been a discrepancy on whether or not Bob-Waksberg decided to end <em>BoJack Horseman</em> at Season 6 or if <a href="https://www.cinemablend.com/television/2481223/why-is-netflixs-bojack-horseman-ending-aaron-paul-seems-to-have-a-different-explanation" data-original-url="https://www.cinemablend.com/television/2481223/why-is-netflixs-bojack-horseman-ending-aaron-paul-seems-to-have-a-different-explanation">Netflix said it was time</a> to pull the plug. Few could blame Bob-Waksberg if he has an ax to grind against the mega streaming service, and will continue to take shots at it and other streaming services when he can.</p><p><a href="https://www.cinemablend.com/television/2475976/all-the-netflix-shows-that-have-been-cancelled-in-2019-so-far" data-original-url="https://www.cinemablend.com/television/2475976/all-the-netflix-shows-that-have-been-cancelled-in-2019-so-far">All The Netflix Shows That Have Been Cancelled In 2019 So Far</a></p><p>Do you watch the end credits at the end of television shows? Sound off in our poll and be sure to stick with CinemaBlend for the latest news in television and movies.</p><p>This poll is no longer available.</p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ The 10 Best Netflix Original TV Shows Of 2019 ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/2487346/the-10-best-netflix-original-tv-shows-of-2019</link>
                                                                            <description>
                            <![CDATA[ It's so hard to pick just 10! What would make your list? ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">eWXDoVLx9LWQkgmc4mNRMM</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/qt5nZj5xn8eTqVNiUHmVwS-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Fri, 27 Dec 2019 20:24:38 +0000</pubDate>                                                                                                                                <updated>Sat, 28 Dec 2019 23:07:28 +0000</updated>
                                                                                                                                            <category><![CDATA[Streaming News]]></category>
                                                                                                                    <dc:creator><![CDATA[ Gina Carbone ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/hKKGVpF6eFDFeak9TgxhQX.png ]]></dc:source>
                                                                <dc:description><![CDATA[ null ]]></dc:description>
                                                                                                                                <cf:isSponsored>false</cf:isSponsored>
                <cf:hasAffiliateLinks>false</cf:hasAffiliateLinks>
                <cf:isPaid>false</cf:isPaid>
                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/qt5nZj5xn8eTqVNiUHmVwS-1280-80.jpg">
                                                            <media:credit><![CDATA[Netflix]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[I Think You Should Leave With Tim Robinson, Unbelievable, Russian Doll]]></media:description>                                                            <media:text><![CDATA[I Think You Should Leave With Tim Robinson, Unbelievable, Russian Doll]]></media:text>
                                <media:title type="plain"><![CDATA[I Think You Should Leave With Tim Robinson, Unbelievable, Russian Doll]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/qt5nZj5xn8eTqVNiUHmVwS-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>Netflix had some fantastic <a href="https://www.cinemablend.com/television/2477085/11-awesome-netflix-originals-premiering-in-august-2019" data-original-url="https://www.cinemablend.com/television/2477085/11-awesome-netflix-originals-premiering-in-august-2019">original TV shows</a> in 2019, and they ranged across every genre. It's really hard to pick just 10 to name the "best" Netflix Originals of any year, since we all have our favorites for different reasons. Not to mention there being so many options from the past 12 months.</p><p>Here are my choices for the 10 best Netflix original TV shows of 2019, accounting for both brand new shows and the most current seasons of already established series. And please share your "best" lists in the comments!</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="JRtv7ZS9rudmRxhyRdaS8d" name="" alt="Dead to Me Season 1 Linda Cardellini Christina Applegate" src="https://cdn.mos.cms.futurecdn.net/JRtv7ZS9rudmRxhyRdaS8d.jpg" mos="https://cdn.mos.cms.futurecdn.net/JRtv7ZS9rudmRxhyRdaS8d.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="10-dead-to-me-season-1">10. Dead To Me Season 1</h2><p>This Netflix comedy was a pleasant surprise for me. It still feels like more of a mystery-drama than a dark comedy, but the comedy that's in there is so sharp and witty -- especially from Christina Applegate. The twists are paced out perfectly across the 10 episodes, nothing is played out too long and the cliffhanger in the end is so tantalizing for Season 2. There are multiple layers to appreciate and so much to look forward to in its return. And Linda Cardellini? You are a gift.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="jXezqhpBRd8PxfQCKeErpe" name="" alt="I Think You Should Leave With Tim Robinson Will Forte plane episode" src="https://cdn.mos.cms.futurecdn.net/jXezqhpBRd8PxfQCKeErpe.jpg" mos="https://cdn.mos.cms.futurecdn.net/jXezqhpBRd8PxfQCKeErpe.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="9-i-think-you-should-leave-with-tim-robinson-season-1">9. I Think You Should Leave With Tim Robinson Season 1</h2><p>As sketch comedy goes, nothing can ever top Monty Python for me. But every so often a broad sketch comedy show will get me laughing out loud -- from <em>The Kids in the Hall</em> and <em>The State</em> to the occasional <em>SNL</em> sketch, most of <em>Key & Peele</em>, <em>Chappelle's Show</em>, and <em>Portlandia</em>. And now, Netflix's <em>I Think You Should Leave With Tim Robinson</em>. There's a lot of <em>Portlandia</em> mixed with <em>Kids in the Hall</em> in the six star-studded but much-too-brief episodes of Season 1. I binged them all and was genuinely upset when I realized that was it. It's a must-watch and a must-return for Season 2, which should be coming in 2020.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="zM8KEnzHsMQdSTWNXG9kXY" name="" alt="BoJack Horseman Season 6" src="https://cdn.mos.cms.futurecdn.net/zM8KEnzHsMQdSTWNXG9kXY.jpg" mos="https://cdn.mos.cms.futurecdn.net/zM8KEnzHsMQdSTWNXG9kXY.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="8-bojack-horseman-season-6-part-1">8. BoJack Horseman Season 6, Part 1</h2><p>We will soon be living in a world without new BoJack. Netflix's animated comedy is in the middle of airing its sixth and final season. Part 1 streamed eight episodes in October 2019, with Part 2 coming January 31, 2020. Critics and fans have pretty much been in agreement about the awesomeness of <em>BoJack Horseman</em> since Season 2. So far, Season 6 is continuing the trend of poignant brilliance. It's going to be hard to say goodbye, but I'm sure you'll find the final episodes back on this list for 2020.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="4KF7TfUZETecacfsFRziTL" name="" alt="Stranger Things Season 3 Robin Steve Dustin" src="https://cdn.mos.cms.futurecdn.net/4KF7TfUZETecacfsFRziTL.jpg" mos="https://cdn.mos.cms.futurecdn.net/4KF7TfUZETecacfsFRziTL.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="7-stranger-things-season-3">7. Stranger Things Season 3</h2><p><em>Stranger Things</em> is like comfort food now. I delight in reliving the cheese of the 1980s, and Season 3 indulged that in every respect. Since the kids are no longer kids, we got to see their awkward dating rituals and spent A LOT of time at the mall. <em>Stranger Things</em> always has at least one new breakout star, and this year we had both Maya Hawke's amazing Robin and Alec Utgoff's Dr. Alexei with his Slurpee. I always love the show, but I'm glad Season 4 is poised to finally mix things up by moving forward out of Hawkins. And of course Hopper will be back. You knew that.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="Evb8NV8tydVRr4imNBJVnT" name="" alt="When They See Us protesters outside courthouse" src="https://cdn.mos.cms.futurecdn.net/Evb8NV8tydVRr4imNBJVnT.jpg" mos="https://cdn.mos.cms.futurecdn.net/Evb8NV8tydVRr4imNBJVnT.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="6-when-they-see-us">6. When They See Us</h2><p>Some of the best Netflix shows of the year were based on real crimes, horrific ones, retelling those stories across several episodes. This is Netflix's true niche, even when some of the real-life events depicted are questioned by people who were really there, <a href="https://www.cinemablend.com/television/2475935/netflixs-when-they-see-us-called-total-nonsense-by-ex-nypd-detective" data-original-url="https://www.cinemablend.com/television/2475935/netflixs-when-they-see-us-called-total-nonsense-by-ex-nypd-detective">as happened in this case</a>. Ava DuVernay created and directed this harrowing four-part examination of the 1989 Central Park Jogger case from the perspective of the five adolescents who were ultimately found to be wrongly convicted of rape and assault. The actors help us empathize with "the boys" -- as they're called -- and their families until it's almost too heartbreaking to watch. But I'm glad <a href="https://www.cinemablend.com/television/2475085/netflixs-most-watched-series-right-now-may-surprise-you-its-not-lucifer-or-black-mirror" data-original-url="https://www.cinemablend.com/television/2475085/netflixs-most-watched-series-right-now-may-surprise-you-its-not-lucifer-or-black-mirror">so many people did watch</a> because, exact details or not, the crux of this really happened.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="XB7GxVeiDqWSaeFzDurjjj" name="" alt="Santa Clarita Diet bloody kitchen" src="https://cdn.mos.cms.futurecdn.net/XB7GxVeiDqWSaeFzDurjjj.jpg" mos="https://cdn.mos.cms.futurecdn.net/XB7GxVeiDqWSaeFzDurjjj.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="5-santa-clarita-diet-season-3">5. Santa Clarita Diet Season 3</h2><p>For the love of Mr. Ball Legs, WHY did Netflix cancel this show after three seasons and that cliffhanger? I'm <a href="https://www.cinemablend.com/television/2470923/netflix-cancelled-santa-clarita-diet-and-timothy-olyphant-had-the-perfect-response" data-original-url="https://www.cinemablend.com/television/2470923/netflix-cancelled-santa-clarita-diet-and-timothy-olyphant-had-the-perfect-response">with Timothy Olyphant</a>, I think the stars should just keep showing up on set to do scenes and if Netflix doesn't want to film them, so be it. I wasn't expecting to get so invested in this horror comedy, but it's probably the best work Drew Barrymore has ever done and the entire cast has impeccable comedic timing. Not every show has to have "likable" characters, but I loved just about everyone on this show and kept rooting for them -- even severed head Gary (Nathan Fillion, then Alan Tudyk). This show slowly became one of my favorite comedies, and I will forever be bitter that it's gone too soon.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="Y5vsDH6DsCj797XNECYvW" name="" alt="Mindhunter Season 2 interrogation" src="https://cdn.mos.cms.futurecdn.net/Y5vsDH6DsCj797XNECYvW.jpg" mos="https://cdn.mos.cms.futurecdn.net/Y5vsDH6DsCj797XNECYvW.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="4-mindhunter-season-2">4. Mindhunter Season 2</h2><p>Netflix excels in several genres, and I'd put true crime toward the top. The streamer's documentary films and docuseries are among the best ever produced. In the past few years, Netflix has stepped into the scripted crime genre and this year they hit it out of the park on multiple fronts. <em>Mindhunter</em> premiered Season 1 in 2017, based on the true crime book <em>Mindhunter: Inside the FBI's Elite Serial Crime Unit</em>. David Fincher is one of the producers and directed several episodes. That was the same for Season 2, which had a lot to live up to when it released nine episodes in 2019. Season 2 was just as absorbing and disturbing and there's every expectation that Season 3 -- <a href="https://www.cinemablend.com/television/2485529/why-netflixs-mindhunter-season-3-is-on-hold" data-original-url="https://www.cinemablend.com/television/2485529/why-netflixs-mindhunter-season-3-is-on-hold">whenever it eventually arrives</a> -- will continue to match the kind of quality you get when Fincher's name is attached.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="cGF5DvX3uArB8eNYyRL8in" name="" alt="The Crown Olivia Colman queen Tobias Menzies Prince Philip" src="https://cdn.mos.cms.futurecdn.net/cGF5DvX3uArB8eNYyRL8in.jpg" mos="https://cdn.mos.cms.futurecdn.net/cGF5DvX3uArB8eNYyRL8in.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="3-the-crown-season-3">3. The Crown Season 3</h2><p>I'm of the opinion that <em>The Crown</em> Season 3 wasn't as strong as the first two seasons, but those were <em>high</em> bars. There's no stopping this show from being one of the greatest ever produced. Besides, there were several saving graces -- including the "Aberfan" episode, which might be the most powerful hour the Netflix show has ever done. And while I expected Helena Bonham Carter to shine as the new Princess Margaret, I found myself wanting to spend more time with everyone <em>but</em> the queen and princess. Tobias Menzies managed to steal the entire season as Prince Philip; I'm not surprised they gave him so much of a showcase, he was extraordinary. Here's looking forward to more from Erin Doherty's Princess Anne and Josh O'Connor as Prince Charles in Season 4. Plus <a href="https://www.cinemablend.com/television/2484976/after-the-crown-season-3-prepare-for-brilliant-gillian-anderson-in-season-4" data-original-url="https://www.cinemablend.com/television/2484976/after-the-crown-season-3-prepare-for-brilliant-gillian-anderson-in-season-4">Gillian Anderson as Margaret Thatcher</a>!</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="Fy7eK3LYRkHp6sEf34g6Jf" name="" alt="Natasha Lyonne as Nadia in Russian Doll Season 1" src="https://cdn.mos.cms.futurecdn.net/Fy7eK3LYRkHp6sEf34g6Jf.png" mos="https://cdn.mos.cms.futurecdn.net/Fy7eK3LYRkHp6sEf34g6Jf.png" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="2-russian-doll-season-1">2. Russian Doll Season 1</h2><p>I went back-and-forth on making this #1 or #2. I'm still torn. This show is <a href="https://www.cinemablend.com/television/2466257/russian-doll-is-one-of-netflixs-best-reviewed-shows-yet" data-original-url="https://www.cinemablend.com/television/2466257/russian-doll-is-one-of-netflixs-best-reviewed-shows-yet">such an original triumph</a> on every level. It's not the first show to put a protagonist through a mysterious time loop, <em>Groundhog Day</em>-style, but it's the first to star Natasha Lyonne and give her this outstanding showcase. It's ambitious, funny, moving, deep, quirky, mysterious, bizarre, addictive, everything. <em>Russian Doll</em> got plenty of attention when it came out in February 2019 but still not enough, to me. It probably would've still been a good show without Natasha Lyonne as Nadia, but her inimitable performance makes it an instant classic. Plus, we're getting more in Season 2!</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="bUVVRxSqZoDcktxrtSW42S" name="" alt="Unbelievable miniseries Merritt Wever and Toni Collette" src="https://cdn.mos.cms.futurecdn.net/bUVVRxSqZoDcktxrtSW42S.jpg" mos="https://cdn.mos.cms.futurecdn.net/bUVVRxSqZoDcktxrtSW42S.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><h2 id="1-unbelievable">1. Unbelievable</h2><p>One of the best shows of the year, period, whether on Netflix or not. It was a great year for exploring real-life horrors, too, from <em>When They See Us</em> to HBO's <em>Chernobyl</em>. <em>Unbelievable</em> was eight episodes of brilliant, compelling, infuriating, heartbreaking, storytelling. Merritt Wever deserves every award ever created for her performance as Det. Karen Duvall, with Toni Collette elevating the material as she always does as Det. Grace Rasmussen. The detectives investigated a series of rape cases, with the story ultimately coming back to <a href="https://www.cinemablend.com/television/2487343/last-man-standing-fans-shouldnt-expect-to-see-kaitlyn-dever-much-anymore" data-original-url="https://www.cinemablend.com/television/2487343/last-man-standing-fans-shouldnt-expect-to-see-kaitlyn-dever-much-anymore">the amazing Kaitlyn Dever</a> as Marie Adler, who was initially charged with lying about being raped. There are heroes and villains across the board here, but all but one are humanized. We understand why they made the decisions they made, including the flawed and <a href="https://www.cinemablend.com/television/2481219/how-the-real-marie-adler-feels-about-netflix-unbelievable" data-original-url="https://www.cinemablend.com/television/2481219/how-the-real-marie-adler-feels-about-netflix-unbelievable">very real Marie herself</a>. Watch <em>Unbelievable</em> <a href="https://www.netflix.com/title/80153467">here on Netflix</a>.</p><p><strong>Honorable mentions</strong>: I wish I could go on to 20 or 30! I'd also add the stellar new seasons from <em>GLOW</em>, <em>Orange Is the New Black</em>, <em>Unbreakable Kimmy Schmidt</em>, <em>3%</em>, <em>Marianne</em>, <em>Money Heist</em>, <em>The Dark Crystal: Age of Resistance</em>, <em>The OA</em>, and <em>Anne With an E</em>, which is why so many fans are <a href="https://www.cinemablend.com/television/2478869/the-oa-wont-be-getting-a-series-finale-movie-at-netflix" data-original-url="https://www.cinemablend.com/television/2478869/the-oa-wont-be-getting-a-series-finale-movie-at-netflix">upset over <em>The OA</em>'s</a> and also <a href="https://www.cinemablend.com/television/2485603/fans-are-devastated-after-surprise-netflix-cancellation-of-anne-with-an-e" data-original-url="https://www.cinemablend.com/television/2485603/fans-are-devastated-after-surprise-netflix-cancellation-of-anne-with-an-e"><em>Anne</em>'s cancellations</a>. There are so many docuseries I could add too, including <em>The Disappearance of Madeleine McCann</em>, which was the most exhaustive and illuminating Netflix documentary series of the year, to me.</p><p>As much as I love <em>Arrested Development</em>, I wouldn't put Season 5, Part 2 on the list of the 10 best of 2019. I know a lot of people loved <em>The Umbrella Academy</em> Season 1, and I wish I was on that list. What about <em>The Politician</em>, <em>The Punisher</em> Season 2, <em>Jessica Jones</em> Season 3? What else would you add?</p><p>I know your list would look very different, so what were the 10 best Netflix Original Series of 2019 to you? And don't forget, there's plenty more to come next year. Keep up with all of Netflix's 2020 premiere and return dates with <a href="https://www.cinemablend.com/television/2485936/2020-netflix-schedule-premiere-dates-for-new-and-returning-shows" data-original-url="https://www.cinemablend.com/television/2485936/2020-netflix-schedule-premiere-dates-for-new-and-returning-shows">our handy schedule</a>.</p><p>This poll is no longer available.</p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ 12 Terrific Shows Coming To Netflix In January 2020 ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/2486865/12-terrific-shows-coming-to-netflix-in-january-2020</link>
                                                                            <description>
                            <![CDATA[ Here are some great shows headed down the pipeline for Netflix in January. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">ftTLZmmAWparb67wGCNYge</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/JNpRCNS36Fk5i9rt5ELi2H-1280-80.png" type="image/png" length="0"></enclosure>
                                                                        <pubDate>Sat, 21 Dec 2019 14:35:58 +0000</pubDate>                                                                                                                                <updated>Sun, 22 Dec 2019 23:20:24 +0000</updated>
                                                                                                                                            <category><![CDATA[Streaming News]]></category>
                                                                                                <author><![CDATA[ mick.joest@CinemaBlend.com (Mick Joest) ]]></author>                    <dc:creator><![CDATA[ Mick Joest ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/4dnBaqggYBopRBZtr5dHzg.png ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Mick Joest is a Content Producer for CinemaBlend with his hand in an eclectic mix of television goodness. Star Trek is his main jam, but he also regularly reports on happenings in the world of Star Trek, WWE, Doctor Who, 90 Day Fiancé, Quantum Leap, and Big Brother. He graduated from the University of Southern Indiana with a degree in Journalism and a minor in Radio and Television. He&#039;s great at hosting panels and appearing on podcasts if given the chance as well.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What He&#039;s Into&lt;/strong&gt;: Most everything Mick reports on because he&#039;s passionate and a fan of the subject. He really loves interviewing people and getting the bigger answers to questions. Outside of work, he&#039;s a sports fan who supports the Indiana Pacers, as well as the New England Patriots.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What He&#039;s Excited About Right Now&lt;/strong&gt;: Mick is excited for the tentative ending of the writer&#039;s strike and for more of his favorite shows like Quantum Leap and Star Trek: Strange New Worlds to finish out their in-development seasons.&amp;nbsp;&lt;/p&gt; ]]></dc:description>
                                                                                                                                <cf:isSponsored>false</cf:isSponsored>
                <cf:hasAffiliateLinks>false</cf:hasAffiliateLinks>
                <cf:isPaid>false</cf:isPaid>
                                                                                                                                <media:content type="image/png" url="https://cdn.mos.cms.futurecdn.net/JNpRCNS36Fk5i9rt5ELi2H-1280-80.png">
                                                            <media:credit><![CDATA[null]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[Bojack Horseman Netflix]]></media:description>                                                            <media:text><![CDATA[Bojack Horseman Netflix]]></media:text>
                                <media:title type="plain"><![CDATA[Bojack Horseman Netflix]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/JNpRCNS36Fk5i9rt5ELi2H-1280-80.png" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>January is the start of a new decade, and a new era for Netflix. The year 2020 will see many other big names enter into streaming, so expect the streaming giant to defend its crown with even more great content and surprise additions to its lineup.</p><p>It's hard to say what new shows on this list could be that next sleeper hit for Netflix, though there's no denying quite a few have potential. Jump down below to see what show's will kick off the decade, and which classics will take their final bow right as 2020 kicks off.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="sTCyF8hinDyFEfqEwCDqgG" name="" alt="Messiah Netflix" src="https://cdn.mos.cms.futurecdn.net/sTCyF8hinDyFEfqEwCDqgG.jpg" mos="https://cdn.mos.cms.futurecdn.net/sTCyF8hinDyFEfqEwCDqgG.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="messiah-1-1">Messiah 1/1</h2><p>Netflix is diving into the world of modern-day prophets with a series that imagines what would happen if a Messianic figure appeared in today's modern world. One CIA officer is tasked with investigating the individual, his massive following, and whether or not the miracles he's allegedly performing are the real deal or this is just the work of a con man who has duped a world ready to believe.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="tH5BUx2kp78ajGxqCmkTM8" name="" alt="Spinning Out Netflix" src="https://cdn.mos.cms.futurecdn.net/tH5BUx2kp78ajGxqCmkTM8.jpg" mos="https://cdn.mos.cms.futurecdn.net/tH5BUx2kp78ajGxqCmkTM8.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="spinning-out-1-1">Spinning Out 1/1</h2><p>Kaya Scodelario and January Jones star in a figure skating drama that takes the action on and off the ice. Kat Baker is an up-and-coming skater fresh off of a bad performance, and hoping to revitalize her career amidst a lot of family drama. Her goal is making it to the Olympics, and it sounds like that goal will be quite an uphill battle that should make for great television. Oh yeah, and <a href="https://www.cinemablend.com/new/Olympian-Johnny-Weir-Cites-Hunger-Games-Fashion-Inspiration-41702.html" data-original-url="https://www.cinemablend.com/new/Olympian-Johnny-Weir-Cites-Hunger-Games-Fashion-Inspiration-41702.html">Johnny Weir plays a character</a>, so this should be a real treat for fans of figure skating.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="qG6BH5G7vLyhicMBoMi7M" name="" alt="The Circle Netflix" src="https://cdn.mos.cms.futurecdn.net/qG6BH5G7vLyhicMBoMi7M.jpg" mos="https://cdn.mos.cms.futurecdn.net/qG6BH5G7vLyhicMBoMi7M.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="the-circle-1-1">The Circle- 1/1</h2><p><em>Big Brother</em> and other reality show fans can prepare for <a href="https://www.cinemablend.com/television/2480934/netflixs-new-reality-competition-the-circle-is-already-super-popular-in-the-uk" data-original-url="https://www.cinemablend.com/television/2480934/netflixs-new-reality-competition-the-circle-is-already-super-popular-in-the-uk">a new obsession</a>. <em>The Circle</em> takes the social element of reality television and removes a key component, looks. Contestants only interact through a social media platform which means they can be whoever they want. Contestants will continually rank each other and the lowest ranked person will get eliminated each time. Will the winner be the person who is the most genuine, or the players who lived a complete lie for prize money?</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="XqHvHiQG7N2BcpnyCVAWrn" name="" alt="Anne With An E Netflix" src="https://cdn.mos.cms.futurecdn.net/XqHvHiQG7N2BcpnyCVAWrn.jpg" mos="https://cdn.mos.cms.futurecdn.net/XqHvHiQG7N2BcpnyCVAWrn.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="anne-with-an-e-final-season-1-3">Anne With An E (Final Season) - 1/3</h2><p><em>Anne With An E</em> has been vastly different than the old Canadian miniseries adaptation of <em>Anne of Green Gables</em>, and fans have responded to it well. Unfortunately, all good things come to an end and the final season will feature Anne setting out to figure out what the rest of her life will look like. Series creator Moira Walley-Beckett expressed some sadness the <a href="https://www.cinemablend.com/television/2485603/fans-are-devastated-after-surprise-netflix-cancellation-of-anne-with-an-e" data-original-url="https://www.cinemablend.com/television/2485603/fans-are-devastated-after-surprise-netflix-cancellation-of-anne-with-an-e">series couldn't continue</a>, but promised this final season will give a satisfying end to Anne's journey.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="iHHbfW6HfVK3mon395KojE" name="" alt="Dracula Netflix" src="https://cdn.mos.cms.futurecdn.net/iHHbfW6HfVK3mon395KojE.jpg" mos="https://cdn.mos.cms.futurecdn.net/iHHbfW6HfVK3mon395KojE.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="dracula-1-4">Dracula- 1/4</h2><p><em>Sherlock</em> and <em>Doctor Who</em> fans, Mark Gatiss and Steven Moffat have <a href="https://www.cinemablend.com/television/1672370/the-team-behind-sherlock-is-making-a-dracula-tv-show-and-were-excited" data-original-url="https://www.cinemablend.com/television/1672370/the-team-behind-sherlock-is-making-a-dracula-tv-show-and-were-excited">a new show</a> for you to fawn over. This upcoming three-part series will revisit the tales of the iconic vampire Dracula, and re-tell the tale in a way only Gatiss and Moffat can. Early footage for this one looks particularly gruesome, so anyone who isn't too comfortable with things that are on the gory side may want to focus on Season 12 of <em>Doctor Who</em> instead.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="e6kFtt8M4XwMKhVKqhJaYA" name="" alt="Medical Police Netflix" src="https://cdn.mos.cms.futurecdn.net/e6kFtt8M4XwMKhVKqhJaYA.jpg" mos="https://cdn.mos.cms.futurecdn.net/e6kFtt8M4XwMKhVKqhJaYA.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="medical-police-1-10">Medical Police- 1/10</h2><p>In what may be one of the more interesting entries in the January Netflix lineup, cult classic <a href="https://www.cinemablend.com/television/2474127/10-best-adult-swim-shows-ever-ranked" data-original-url="https://www.cinemablend.com/television/2474127/10-best-adult-swim-shows-ever-ranked">Adult Swim series</a> <em>Children's Hospital</em> is getting a spinoff. <em>Medical Police</em> follows doctors Owen Maestro and Lola Spratt in Brazil where they uncover a deadly virus. The two are enlisted as government agents, and must work to find a cure and bring whoever is responsible for this illness to justice. Expect things to get goofy, and expect to laugh a good deal.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="PxXtzLhQi9SSLZge8nZfTh" name="" alt="Zumbo's Just Desserts Netflix" src="https://cdn.mos.cms.futurecdn.net/PxXtzLhQi9SSLZge8nZfTh.jpg" mos="https://cdn.mos.cms.futurecdn.net/PxXtzLhQi9SSLZge8nZfTh.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="zumbo-39-s-just-desserts-season-2-1-17">Zumbo's Just Desserts (Season 2)- 1/17</h2><p>One of the most technically intense cooking shows is back! <em>Zumbo's Just Desserts</em> brings back Australian celebrity baker Adriano Zumbo and his over-the-top creations that have shocked chefs worldwide. Contestants will return for another grueling season that demands perfection, creativity, and some of the most <a href="https://www.cinemablend.com/television/2398602/the-8-best-netflix-original-food-shows-ranked" data-original-url="https://www.cinemablend.com/television/2398602/the-8-best-netflix-original-food-shows-ranked?page=6">mouth-watering desserts</a> Netflix subscribers have ever seen. For those looking to stick to a New Year's diet, this may not be the best one to binge.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="n3FLqrH6WtdZ5WaZFRaAvN" name="" alt="Sex Ed Season 2 Netflix" src="https://cdn.mos.cms.futurecdn.net/n3FLqrH6WtdZ5WaZFRaAvN.jpg" mos="https://cdn.mos.cms.futurecdn.net/n3FLqrH6WtdZ5WaZFRaAvN.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="sex-education-season-2-1-17">Sex Education (Season 2)- 1/17</h2><p>Otis is back, but his adventures in Season 1 have come back to bite him in Season 2. He's now navigating his own sexual desires while the school is in the midst of a chlamydia outbreak, and trying to revive his strained relationship with Maeve in the process. Things will only get more complicated as some new kids come to town, and really shake up this entertaining series yet again.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="UfZStcnCdP48gDxJB8jje8" name="" alt="The Ranch Netflix" src="https://cdn.mos.cms.futurecdn.net/UfZStcnCdP48gDxJB8jje8.jpg" mos="https://cdn.mos.cms.futurecdn.net/UfZStcnCdP48gDxJB8jje8.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="the-ranch-final-season-1-24">The Ranch (Final Season)- 1/24</h2><p>A little under four years since its debut, <em>The Ranch</em> is finally airing its final season on Netflix. The Bennetts have some issues on the horizon as Christmas nears, the least of which being that Lisa Neumann is in control of the ranch. The series has weathered the <a href="https://www.cinemablend.com/television/1735869/danny-masterson-has-been-fired-from-netflixs-the-ranch-over-rape-allegations" data-original-url="https://www.cinemablend.com/television/1735869/danny-masterson-has-been-fired-from-netflixs-the-ranch-over-rape-allegations">storm of controversy</a> during its run, can it finish strong and become one of Netflix's most successful originals?</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="QRXQ6erzgRAREtobBoSxAf" name="" alt="The Chilling Adventures Of Sabrina Netflix" src="https://cdn.mos.cms.futurecdn.net/QRXQ6erzgRAREtobBoSxAf.jpg" mos="https://cdn.mos.cms.futurecdn.net/QRXQ6erzgRAREtobBoSxAf.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="the-chilling-adventures-of-sabrina-part-3-1-24">The Chilling Adventures Of Sabrina (Part 3)- 1/24</h2><p>Sabrina Spellman stopped the Dark Lord's reign on Earth, but unfortunately, <a href="https://www.cinemablend.com/television/2470069/how-chilling-adventures-of-sabrina-ended-part-2-for-its-characters" data-original-url="https://www.cinemablend.com/television/2470069/how-chilling-adventures-of-sabrina-ended-part-2-for-its-characters">it cost her the new love of her life</a>. The Dark Lord is trapped inside Nick's body, and unfortunately, there's no saving Nick without risking the devil's escape. Luckily, Harvey, Rosalind, and Theo are down to help Sabrina attempt to rescue Nick from Hell and help the new "Queen" as she defends her title against would-be newcomers hoping to pick up where satan left off. All that and a mysterious carnival in town? This season is about to get crazy.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="BNzzDgZin9qeamFWU29rTU" name="" alt="Next In Fashion Netflix" src="https://cdn.mos.cms.futurecdn.net/BNzzDgZin9qeamFWU29rTU.jpg" mos="https://cdn.mos.cms.futurecdn.net/BNzzDgZin9qeamFWU29rTU.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="next-in-fashion-1-29">Next In Fashion- 1/29</h2><p><em>Queer Eye</em> star Tan France is known for <a href="https://www.cinemablend.com/television/2308061/all-the-netflix-characters-that-need-makeovers-according-to-queer-eyes-new-fab-five" data-original-url="https://www.cinemablend.com/television/2308061/all-the-netflix-characters-that-need-makeovers-according-to-queer-eyes-new-fab-five">his fashion sense</a>, which may be why Netflix tapped him for a competition series where he'll put that to use. <em>Next In Fashion</em> takes up-and-coming people in the fashion industry and gives them a chance to go head-to-head all for a shot of becoming one of the next big names in fashion. Netflix has delivered solid competition shows like <em>Rhythm and Flow</em> in the past, so I'm optimistic about this one being a hit.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="nJF4appqv9QFAXTSNPGMVW" name="" alt="Bojack Horseman Netflix" src="https://cdn.mos.cms.futurecdn.net/nJF4appqv9QFAXTSNPGMVW.jpg" mos="https://cdn.mos.cms.futurecdn.net/nJF4appqv9QFAXTSNPGMVW.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="bojack-horseman-season-6b-1-31">Bojack Horseman (Season 6B)- 1/31</h2><p>Back when <em>Bojack Horseman</em> <a href="https://www.cinemablend.com/television/2483868/bojack-horsemans-creator-thinks-its-a-shame-that-netflix-changed-its-cancellation-policy" data-original-url="https://www.cinemablend.com/television/2483868/bojack-horsemans-creator-thinks-its-a-shame-that-netflix-changed-its-cancellation-policy">first premiered</a>, it would've been laughable to imagine it'd become one of Netflix's most emotional, critically acclaimed, and thought-provoking shows. Now, the ride is finally at an end, and we'd like to think the final part of Season 6 will be just as strong as the rest of the series. For those that haven't gotten a chance to check this one out, make it a New Year's Resolution to do so.</p><p><a href="https://www.cinemablend.com/television/2486543/the-best-shows-on-netflix-that-you-can-binge-over-a-weekend" data-original-url="https://www.cinemablend.com/television/2486543/the-best-shows-on-netflix-that-you-can-binge-over-a-weekend"><strong>Related: The Best Shows On Netflix That You Can Binge Over A Weekend</strong></a></p><p>Be ready to binge all these shows on <a href="https://www.netflix.com/browse">Netflix</a> in January. Be sure to stick with CinemaBlend for all the latest news happening in the world of television and movies.</p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ Netflix New Releases: Movies And TV Shows Streaming In January 2020 ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/news/2486585/netflix-new-releases-movies-and-tv-shows-streaming-in-january-2020</link>
                                                                            <description>
                            <![CDATA[ Here’s how the streaming giant is kicking off the new decade. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">tQ11QDdCcmuiMZZYYpRuj4</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/hTLtzTPQEWEdoU9HzPadHJ-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Wed, 11 Dec 2019 21:07:54 +0000</pubDate>                                                                                                                                                                                                                                <category><![CDATA[Streaming News]]></category>
                                                                                                                    <dc:creator><![CDATA[ Adam Holmes ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/9CVtfkWiSCeQzeXk3JTRpB.png ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Adam is a Senior Content Producer at CinemaBlend. He started working for the site back in late 2014 writing exclusively comic book movie and TV-related articles, and along with branching out into other genres, he also made the jump to editing. Along with his writing and editing duties, as well as interviewing creative talent from time to time, he also oversees the assignment of movie-related features. He graduated from the University of Oregon with a degree in Journalism, and he’s been sourced numerous times on Wikipedia.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What He&#039;s Into&lt;/strong&gt;: Adam has been a fan of Marvel, DC and Star Wars stories since he was little, and among the fandoms he’s joined later in life are Star Trek, Indiana Jones, Doctor Who, John Wick and the MonsterVerse. Additionally, he still dips his toes into the procedural pool by being a dedicated NCIS watcher, and he’s also up for a good historical/period piece movie or TV show every now and then. Adam also enjoys reading, and while nowadays this mostly consists of pouring over comics (thank you for making this easier than ever, DC Universe Infinite and Marvel Unlimited!), he’s making an effort to get back to delving into regular books, including finally reading Dune and revisiting the original Sherlock Holmes stories. Movie-wise, his favorite drama is The Dark Knight and favorite comedy is Anchorman, and on the TV side of things, his favorite drama is Battlestar Galactica and favorite comedy is Scrubs.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What He&#039;s Excited About Right Now&lt;/strong&gt;: Star Trek, Doctor Who, My Adventures with Superman, Only Murders in the Building, Ahsoka.&lt;/p&gt; ]]></dc:description>
                                                                                                                                <cf:isSponsored>false</cf:isSponsored>
                <cf:hasAffiliateLinks>false</cf:hasAffiliateLinks>
                <cf:isPaid>false</cf:isPaid>
                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/hTLtzTPQEWEdoU9HzPadHJ-1280-80.jpg">
                                                            <media:credit><![CDATA[null]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[Uma Thurman in Kill Bill]]></media:description>                                                            <media:text><![CDATA[Uma Thurman in Kill Bill]]></media:text>
                                <media:title type="plain"><![CDATA[Uma Thurman in Kill Bill]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/hTLtzTPQEWEdoU9HzPadHJ-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>We’re almost at the end of 2019, closing out not just this year, but the entire decade. 2020 marks the start of a new era, and Netflix is kicking off the next decade with a bang. For January, <a href="https://www.cinemablend.com/television/2486573/netflix-is-testing-a-feature-that-will-help-stop-endless-browsing" data-original-url="https://www.cinemablend.com/television/2486573/netflix-is-testing-a-feature-that-will-help-stop-endless-browsing">the streaming giant</a> is dropping all sorts of content for subscribers to digest, from well-established movies to new seasons of Netflix-exclusive TV shows. There’ll be something for everyone to enjoy!</p><p>If you’d rather focus on the now, look through our full rundown of <a href="https://www.cinemablend.com/news/2485241/netflix-new-releases-movies-and-tv-shows-streaming-in-december-2019" data-original-url="https://www.cinemablend.com/news/2485241/netflix-new-releases-movies-and-tv-shows-streaming-in-december-2019">what dropped on Netflix in December</a> to plan your watches and/or biggest accordingly. However, for those of you already looking to the future, read on to learn what’s hitting Netflix in January 2020.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="ujECZrQKgeEsx88iy9TQpn" name="" alt="Aragorn in Lord of the Rings: The Return of the King" src="https://cdn.mos.cms.futurecdn.net/ujECZrQKgeEsx88iy9TQpn.jpg" mos="https://cdn.mos.cms.futurecdn.net/ujECZrQKgeEsx88iy9TQpn.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="week-of-january-1">Week Of January 1</h2><p><em>21</em> - 1/1/20</p><p><em>A Cinderella Story</em> - 1/1/20</p><p><em>American Beauty</em> - 1/1/20</p><p><em>Catch Me If You Can</em> - 1/1/20</p><p><em>Charlie and the Chocolate Factory</em> - 1/1/20</p><p><em>Chasing Amy</em> - 1/1/20</p><p><em>Chitty Chitty Bang Bang</em> - 1/1/20</p><p><em>Chloe</em> - 1/1/20</p><p><em>City of God</em> - 1/1/20</p><p><em>Dinner for Schmucks</em> - 1/1/20</p><p><em>Dragonheart</em> - 1/1/20</p><p><em>Dragonheart 3: The Sorcerer</em> - 1/1/20</p><p><em>Dragonheart: A New Beginning</em> - 1/1/20</p><p><em>Drugs, Inc.</em>: Season 6 - 1/1/20</p><p><em>Ferris Bueller's Day Off</em> - 1/1/20</p><p><em>Free Willy</em> - 1/1/20</p><p><em>Good Girls</em>: Season 2 - 1/1/20</p><p><em>Ghost Rider</em> - 1/1/20</p><p><em>Ghost Stories</em> - NETFLIX FILM - 1/1/20</p><p><em>Harold & Kumar Go to White Castle</em> - 1/1/20</p><p><em>Hitch</em> - 1/1/20</p><p><em>Inception</em> - 1/1/20</p><p><em>Instructions Not Included</em> - 1/1/20</p><p><em>Julie & Julia</em> - 1/1/20</p><p><em>Kate & Leopold</em> - 1/1/20</p><p><em>Kill Bill: Vol. 1</em> - 1/1/20</p><p><em>Kill Bill: Vol. 2</em> - 1/1/20</p><p><em>Kingpin</em> - 1/1/20</p><p><em>Kiss the Girls</em> - 1/1/20</p><p><em>Messiah</em> - NETFLIX ORIGINAL - 1/1/20</p><p><em>Monster-in-Law</em> - 1/1/20</p><p><em>New York Minute</em> - 1/1/20</p><p><em>Nisman: Death of a Prosecutor</em> - NETFLIX DOCUMENTARY - 1/1/20</p><p><em>Pan's Labyrinth</em> - 1/1/20</p><p><em>Patriot Games</em> - 1/1/20</p><p><em>Saint Seiya</em>: Season 4-5 - 1/1/20</p><p><em>Seal Team Six: The Raid on Osama Bin Laden</em> - 1/1/20</p><p><em>Shrek Forever After</em> - 1/1/20</p><p><em>Spinning Out</em> - NETFLIX ORIGINAL - 1/1/20</p><p><em>Strictly Ballroom</em> - 1/1/20</p><p><em>Teenage Mutant Ninja Turtles II: The Secret of the Ooze</em> - 1/1/20</p><p><em>Teenage Mutant Ninja Turtles: The Movie</em> - 1/1/20</p><p><em>The Circle</em> - NETFLIX ORIGINAL - 1/1/20</p><p><em>The Lord of the Rings: The Return of the King</em> - 1/1/20</p><p><em>The Lord of the Rings: The Two Towers</em> - 1/1/20</p><p><em>The Naked Gun 2 1/2: The Smell of Fear</em> - 1/1/20</p><p><em>The Naked Gun: From the Files of Police Squad!</em> - 1/1/20</p><p><em>The Original Kings of Comedy</em> - 1/1/20</p><p><em>The Ring</em> - 1/1/20</p><p><em>The Talented Mr. Ripley</em> - 1/1/20</p><p><em>Tremors</em> - 1/1/20</p><p><em>True Grit</em> - 1/1/20</p><p><em>Up in the Air</em> - 1/1/20</p><p><em>What Lies Beneath</em> - 1/1/20</p><p><em>Wild Wild West</em> - 1/1/20</p><p><em>Willy Wonka & the Chocolate Factory</em> - 1/1/20</p><p><em>Wyatt Earp</em> - 1/1/20</p><p><em>Yes Man</em> - 1/1/20</p><p><em>Sex, Explained</em>: Limited Series - NETFLIX DOCUMENTARY - 1/2/20</p><p><em>Thieves the Wood</em> - NETFLIX ORIGINAL - 1/2/20</p><p><em>Anne with an E</em>: The Final Season - NETFLIX ORIGINAL - 1/3/20</p><p><em>All the Freckles in the World</em> - NETFLIX FILM - 1/3/20</p><p><em>Go! Go! Cory Carson</em> - NETFLIX FAMILY - 1/4/20</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="zXnVdT9oFpCahAKrqTHK5j" name="" alt="AJ and the Queen" src="https://cdn.mos.cms.futurecdn.net/zXnVdT9oFpCahAKrqTHK5j.jpg" mos="https://cdn.mos.cms.futurecdn.net/zXnVdT9oFpCahAKrqTHK5j.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="week-of-january-5">Week Of January 5</h2><p><em>Cheer</em> - NETFLIX DOCUMENTARY - 1/8/20</p><p><em>AJ and the Queen</em> - NETFLIX ORIGINAL - 1/10/20</p><p><em>The Evil Dead</em> - 1/10/20</p><p><em>Giri / Haji</em> - NETFLIX ORIGINAL - 1/10/20</p><p><em>Harvey Girls Forever!</em>: Season 4 - NETFLIX FAMILY - 1/10/20</p><p><em>The Inbestigators</em>: Season 2 - NETFLIX FAMILY - 1/10/20</p><p><em>Medical Police</em> - NETFLIX ORIGINAL - 1/10/20</p><p><em>Scissor Seven</em> - NETFLIX ANIME - 1/10/20</p><p><em>Until Dawn</em> - NETFLIX ORIGINAL - 1/10/20</p><p><em>Zumbo’s Just Desserts</em>: Season 2 - NETFLIX ORIGINAL - 1/10/20</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="ZejLuT8MqoG7R47LbyziUB" name="" alt="Grace and Frankie Neflix" src="https://cdn.mos.cms.futurecdn.net/ZejLuT8MqoG7R47LbyziUB.jpg" mos="https://cdn.mos.cms.futurecdn.net/ZejLuT8MqoG7R47LbyziUB.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="week-of-january-12">Week Of January 12</h2><p><em>Betty White: First Lady of Television</em> - 1/12/20</p><p><em>The Healing Powers of Dude</em> - NETFLIX ORIGINAL - 1/13/20</p><p><em>Kip and the Age of Wonderbeasts</em> - NETFLIX FAMILY - 1/14/20</p><p><em>The Master</em> - 1/14/20</p><p><em>Big Fat Liar</em> - 1/15/20</p><p><em>Quien a hierro mata</em> - NETFLIX FILM - 1/15/20</p><p><em>Grace and Frankie</em>: Season 6 - NETFLIX ORIGINAL - 1/15/20</p><p><em>NiNoKuni</em> - NETFLIX ANIME - 1/16/20</p><p><em>Ares</em> - NETFLIX ORIGINAL - 1/17/20</p><p><em>Hip-Hop Evolution</em>: Season 4 - NETFLIX ORIGINAL - 1/17/20</p><p><em>Sex Education</em>: Season 2 - NETFLIX ORIGINAL - 1/17/20</p><p><em>Tiny House Nation</em>: Volume 2 - 1/17/20</p><p><em>Tyler Perry’s A Fall From Grace</em> - NETFLIX FILM - 1/17/20</p><p><em>Vivid dos veces</em> - NETFLIX FILM - 1/17/20</p><p><em>We kann, der kann!</em> - NETFLIX ORIGINAL - 1/17/20</p><p><em>The Bling Ring</em> - 1/18/20</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="wGLhok9LCbYByKBwWRzSgJ" name="" alt="Chilling Adventures of Sabrina Netflix" src="https://cdn.mos.cms.futurecdn.net/wGLhok9LCbYByKBwWRzSgJ.jpg" mos="https://cdn.mos.cms.futurecdn.net/wGLhok9LCbYByKBwWRzSgJ.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="week-of-january-19">Week Of January 19</h2><p><em>Family Reunion</em>: Season 2 - NETFLIX FAMILY - 1/20/20</p><p><em>Fortune Feistier: Sweet & Salty</em> - NETLFIX ORIGINAL - 1/21/20</p><p><em>Word Party</em>: Season 4 - NETFLIX FAMILY - 1/21/20</p><p><em>Pandemic: How to Prevent an Outbreak</em> - 1/22/20</p><p><em>Playing with Fire</em>: Season 1 - 1/22/20</p><p><em>The Ghost Bride</em> - NETFLIX ORIGINAL - 1/23/20</p><p><em>October Faction</em> - NETFLIX ORIGINAL - 1/23/20</p><p><em>The Queen</em> - 1/23/20</p><p><em>SAINT SEIYA: Knights of the Zodiac</em>: Season 1 / Part 2 - NETFLIX ANIME - 1/23/20</p><p><em>A Sun</em> - NETFLIX FILM - 1/24/20</p><p><em>Chilling Adventures of Sabrina</em>: Part 3 - NETFLIX ORIGINAL - 1/24/20</p><p><em>The Ranch</em>: The Final Season - NETFLIX ORIGINAl - 1/24/20</p><p><em>Rise of Empires: Ottoman</em> - NETFLIX ORIGINAL - 1/24/20</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="49QPqaAu8vpNtTeuxnR2nX" name="" alt="N" src="https://cdn.mos.cms.futurecdn.net/49QPqaAu8vpNtTeuxnR2nX.jpg" mos="https://cdn.mos.cms.futurecdn.net/49QPqaAu8vpNtTeuxnR2nX.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="week-of-january-26">Week Of January 26</h2><p><em>Vir Das: For India</em>: NETLFIX ORIGINAL - 1/26/20</p><p><em>Country Strong</em> - 1/27/20</p><p><em>We Are Your Friends</em> - 1/27/20</p><p><em>Alex Fernández: El mejor comediante del mundo</em> - NETFLIX ORIGINAL - 1/28/20</p><p><em>Frères Ennemis</em> - NETFLIX FILM - 1/29/20</p><p><em>Next In Fashion</em> - NETFLIX ORIGINAL - 1/29/20</p><p><em>Night on Earth</em> - NETFLIX DOCUMENTARY - 1/29/20</p><p><em>Omniscient</em> - NETFLIX ORIGINAL - 1/29/20</p><p><em>Ainori Love Wagon: African Journey</em> - NETFLIX ORIGINAL - 1/30/20</p><p><em>Nighthawks</em> - 1/30/20</p><p><em>Raising Cain</em> - 1/30/20</p><p><em>The Stranger</em> - NETFLIX ORIGINAL - 1/30/20</p><p><em>37 Seconds</em> - NETFLIX FILM - 1/31/20</p><p><em>American Assassin</em> - 1/31/20</p><p><em>Bojack Horseman</em>: Season 6 (Part B) - NETLIX ORIGINAL - 1/31/20</p><p><em>Diablero</em>: Season 2 - NETLIX ORIGINAL - 1/31/20</p><p><em>I AM A KILLER</em>: Season 2 - NETLIX ORIGINAL - 1/31/20</p><p><em>Luna Nera</em> - NETLIX ORIGINAL - 1/31/20</p><p><em>Ragnarok</em> - NETLIX ORIGINAL - 1/31/20</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="v2Ft4MeTP7b3bYauyVFwA6" name="" alt="" src="https://cdn.mos.cms.futurecdn.net/v2Ft4MeTP7b3bYauyVFwA6.jpg" mos="https://cdn.mos.cms.futurecdn.net/v2Ft4MeTP7b3bYauyVFwA6.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="tbd">TBD</h2><p><em>Dracula</em> - NETFLIX ORIGINAL</p><p><em>What the Love! with Karan Johar</em> - NETFLIX ORIGINAL</p><p>As you can see, Netflix is dropping <em>a lot</em> of original content in January 2020, further cementing how the company is pulling out the stops to draw people in with its own work. <a href="https://www.cinemablend.com/television/2486360/netflix-now-has-more-tv-shows-but-fewer-movies-than-5-years-ago-smart-trend" data-original-url="https://www.cinemablend.com/television/2486360/netflix-now-has-more-tv-shows-but-fewer-movies-than-5-years-ago-smart-trend">On the TV side of things</a>, Several shows will be making their exits, including <em>Bojack Horseman</em> (airing the latter half of <a href="https://www.cinemablend.com/television/2483868/bojack-horsemans-creator-thinks-its-a-shame-that-netflix-changed-its-cancellation-policy" data-original-url="https://www.cinemablend.com/television/2483868/bojack-horsemans-creator-thinks-its-a-shame-that-netflix-changed-its-cancellation-policy">its final season</a>, with the first half dropping in October), <em>Anne with an E</em> and <em>The Ranch</em>, while <em>Grace and Frankie</em> is returning for its penultimate season. On the movie’s side, you have offerings like <em>Tyler Perry’s A Fall From Grace</em> (this marking the <a href="https://www.cinemablend.com/news/2485606/surprise-tyler-perrys-first-post-madea-movie-will-be-heading-to-netflix" data-original-url="https://www.cinemablend.com/news/2485606/surprise-tyler-perrys-first-post-madea-movie-will-be-heading-to-netflix">first collaboration between the filmmaker and Netflix</a>) and the horro anthology <em>Ghost Stories</em>.</p><p>But there’s also plenty of movies from elsewhere to absorb. In the movies realm, <em>Lord of the Rings</em> and <em>Naked Gun</em> fans will have two movies in each trilogy to watch (hopefully the first entry of the former and the final entry in the latter will be added soon after), and Quentin Tarantino fans will be able to stream both chapters of the <em>Kill Bill</em> story (remember, Tarantino considers that tale <a href="https://www.cinemablend.com/news/2477070/quentin-tarantino-finally-answers-is-kill-bill-one-movie-or-two" data-original-url="https://www.cinemablend.com/news/2477070/quentin-tarantino-finally-answers-is-kill-bill-one-movie-or-two">to be one movie</a>). Other classics that will just be a click away include <em>Ferris Bueller’s Day Off</em>, <em>Inception</em>, <em>Pan’s Labyrinth</em>, <em>Tremors</em> and <em>True Grit</em> (though it’s unclear if this is the original or 2010 remake).</p><p>So there you have it! These are all the new offerings <a href="https://www.netflix.com">Netflix</a> will be providing in January 2020. That said, keep in mind that the titles above are, as always, subject to change and availability. So if you’re having trouble tracking down one of next months’ new arrivals, consult our guide again to make sure you kept everything straight. And also keep in mind what region you’re watching Netflix from, as that may change whether any of the above titles will be available next month.</p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ BoJack Horseman's Creator Thinks 'It's A Shame' That Netflix Changed Its Cancellation Policy ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/2483868/bojack-horsemans-creator-thinks-its-a-shame-that-netflix-changed-its-cancellation-policy</link>
                                                                            <description>
                            <![CDATA[ The BoJack Horseman creator doesn't like Netflix's new cancellation model. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">dwFMrSY5CoNp9LUTqQvY3R</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/3gaKnkYnWiP8WfBUUojE2h-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Tue, 05 Nov 2019 19:52:07 +0000</pubDate>                                                                                                                                                                                                                                <category><![CDATA[Streaming News]]></category>
                                                                                                                    <dc:creator><![CDATA[ Mae Abdulbaki ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/rDwG3VYfTHZaYR8QaKsTh9.png ]]></dc:source>
                                                                <dc:description><![CDATA[ null ]]></dc:description>
                                                                                                                                <cf:isSponsored>false</cf:isSponsored>
                <cf:hasAffiliateLinks>false</cf:hasAffiliateLinks>
                <cf:isPaid>false</cf:isPaid>
                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/3gaKnkYnWiP8WfBUUojE2h-1280-80.jpg">
                                                            <media:credit><![CDATA[null]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[bojack horseman creator netflix cancellation policy]]></media:description>                                                            <media:text><![CDATA[bojack horseman creator netflix cancellation policy]]></media:text>
                                <media:title type="plain"><![CDATA[bojack horseman creator netflix cancellation policy]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/3gaKnkYnWiP8WfBUUojE2h-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>When <em>BoJack Horseman</em> premiered on Netflix in 2014, the streaming service was still relatively new to the world of original programming. Back then, Netflix didn’t care about ratings in the same way traditional networks did and they largely stuck by that. In the wake of <em>Tuca & Bertie’s</em> abrupt cancellation, however, <a href="https://www.cinemablend.com/television/2383602/bojack-horseman-creator-has-a-new-show-coming-but-not-for-netflix" data-original-url="https://www.cinemablend.com/television/2383602/bojack-horseman-creator-has-a-new-show-coming-but-not-for-netflix"><em>BoJack Horseman</em> creator Raphael Bob-Waksberg</a> thinks “it’s a shame” that Netflix has changed its cancellation policy.</p><p>In the early days, shows like <a href="https://www.cinemablend.com/television/2457791/bojack-horsemans-best-season-5-episode-is-another-format-breaking-masterpiece" data-original-url="https://www.cinemablend.com/television/2457791/bojack-horsemans-best-season-5-episode-is-another-format-breaking-masterpiece"><em>BoJack Horseman</em> took some time to build an audience</a>. With so many shows to watch now, not everyone is sitting down to binge the series during its opening weekend. <em>BoJack’s</em> creator argues that the streaming service is no longer allowing its shows the time to build the audience the same way that it used to.</p><p>In an interview with the <a href="https://www.latimes.com/entertainment-arts/tv/story/2019-11-04/netflix-raphael-bob-waksberg-bojack-horseman">Los Angeles Times</a>, <em>BoJack Horseman’s</em> Raphael Bob-Waksberg, an executive producer on the recently cancelled <a href="https://www.cinemablend.com/television/2463314/10-best-adult-animation-christmas-specials-on-streaming" data-original-url="https://www.cinemablend.com/television/2463314/10-best-adult-animation-christmas-specials-on-streaming">animated series <em>Tuca & Bertie</em></a>, shared his feelings about Netflix’s new cancellation model and he isn't a fan.</p><div><blockquote><p>When we started on BoJack, it was understood that the Netflix model was to give shows time to find an audience, and to build that audience, and I remember being told, ‘We expect the biggest day BoJack Season 1 is going to have is when we launch BoJack Season 2.’ We didn’t get a full two-season pickup, but that was the understanding, that these things take time to build. It was my understanding that that was, at the time, the Netflix model: to give shows time to build. I think it’s a shame that they seem to have moved away from that model.</p></blockquote></div><p>Raphael Bob-Waksberg offers some food for thought regarding Netflix’s changing policy. This year alone, the streaming service not only cancelled <em>Tuca & Bertie</em> after one season, though it's being shopped around to other networks, but also <a href="https://www.cinemablend.com/television/2475976/all-the-netflix-shows-that-have-been-cancelled-in-2019-so-far" data-original-url="https://www.cinemablend.com/television/2475976/all-the-netflix-shows-that-have-been-cancelled-in-2019-so-far">axed the beloved and critically acclaimed comedy <em>One Day at a Time</em></a>. It left many wondering why ratings were suddenly more important to Netflix’s decision making.</p><p>When looking at it that way, <em>BoJack Horseman</em>, which is <a href="https://www.cinemablend.com/television/2481223/why-is-netflixs-bojack-horseman-ending-aaron-paul-seems-to-have-a-different-explanation" data-original-url="https://www.cinemablend.com/television/2481223/why-is-netflixs-bojack-horseman-ending-aaron-paul-seems-to-have-a-different-explanation">currently in its sixth and final season</a>, might not have gotten past Season 1, especially since audiences didn’t find it until much later. However, it seems likely that Netflix will continue centering renewals around ratings.</p><p>It was made obvious that Netflix now views those numbers as very important when it released its ratings report last month, citing <a href="https://www.cinemablend.com/television/2482489/netflix-reveals-10-most-watched-shows-from-the-past-year" data-original-url="https://www.cinemablend.com/television/2482489/netflix-reveals-10-most-watched-shows-from-the-past-year">which TV shows had landed the most viewership</a> over the last year. This list was based on the number of people who had watched at least 70% of any individual series. Regardless of how the ratings were tabulated, though, it was clear Netflix had shifted its stance on the use of ratings in renewal decisions, especially considering that the company had never released such rankings to the public before.</p><p>Thankfully, <em>Bojack Horseman</em> did go on for as long as it did, and it's now considered one of the best shows on Netflix. The first eight episodes of <em>BoJack's</em> sixth and final season arrived on Netflix in October, with the remaining eight episodes set to drop on January 31, 2020. While on the topic of Netflix, be sure to check out our <a href="https://www.cinemablend.com/television/best-netflix-tv-shows-ranked-72599.html" data-original-url="https://www.cinemablend.com/television/best-netflix-tv-shows-ranked-72599.html">ranked list of the best original shows</a> the streaming service has to offer.</p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ Why Is Netflix's Bojack Horseman Ending? Aaron Paul Seems To Have A Different Explanation ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/2481223/why-is-netflixs-bojack-horseman-ending-aaron-paul-seems-to-have-a-different-explanation</link>
                                                                            <description>
                            <![CDATA[ Aaron Paul is speaking out about what happened. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">oD2to21yuNptagr9K1vwtZ</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/KQQyHXnjPzAqZvuD9kNm7Z-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Sun, 29 Sep 2019 15:19:30 +0000</pubDate>                                                                                                                                <updated>Sun, 29 Sep 2019 15:20:06 +0000</updated>
                                                                                                                                            <category><![CDATA[Television]]></category>
                                                                                                                    <dc:creator><![CDATA[ Jessica Rawden ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/gNi5ipvqyWREFVbs7Ehzx9.png ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background:&lt;/strong&gt; Jessica Rawden is Managing Editor at CinemaBlend. She’s been kicking out news stories at CinemaBlend since 2007 and joined the full-time staff in 2014. She oversees news content, hiring and training for the site, and her areas of expertise include theme parks, rom-coms, Hallmark (particularly Christmas movie season), reality TV, celebrity interviews and primetime. She loves a good animated movie.&amp;nbsp;&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;Jessica has a Masters in Library Science degree from Indiana University, and used to be found behind a reference desk most definitely not shushing people. She now uses those skills in researching and tracking down information in very different ways.&amp;nbsp;&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What She’s Into&lt;/strong&gt;: A former soccer player and recent tennis addict, Jessica also enjoys running, both of the distance and sprint variety. When not at the movie theater, her other free time is spent in book clubs, hiking, drinking wine, binge-watching, keeping tabs on celebrity fashion and riding rollercoasters. Has a serious Hallmark and Avon romance habit and an even bigger record-buying habit. Will bake for compliments.&amp;nbsp;&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What She’s Excited About Right Now&lt;/strong&gt;: &amp;nbsp;Stone fruit season, Fall TV, and her next ride on the VelociCoaster. &amp;nbsp;&amp;nbsp;&amp;nbsp;&amp;nbsp;&lt;/p&gt; ]]></dc:description>
                                                                                                                                <cf:isSponsored>false</cf:isSponsored>
                <cf:hasAffiliateLinks>false</cf:hasAffiliateLinks>
                <cf:isPaid>false</cf:isPaid>
                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/KQQyHXnjPzAqZvuD9kNm7Z-1280-80.jpg">
                                                            <media:credit><![CDATA[null]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[BoJack Horseman Season 6 still from the trailer]]></media:description>                                                            <media:text><![CDATA[BoJack Horseman Season 6 still from the trailer]]></media:text>
                                <media:title type="plain"><![CDATA[BoJack Horseman Season 6 still from the trailer]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/KQQyHXnjPzAqZvuD9kNm7Z-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>Aaron Paul may be having a good working stretch thanks to gigs in the upcoming <em>Truth Be Told</em> series, a job in <em>Westworld</em>, and <a href="https://www.cinemablend.com/television/2480825/full-el-camino-trailer-reveals-jesses-super-stressful-life-after-breaking-bad" data-original-url="https://www.cinemablend.com/television/2480825/full-el-camino-trailer-reveals-jesses-super-stressful-life-after-breaking-bad">a return to playing Jesse Pinkman</a> in <em>El Camino: A Breaking Bad Movie</em>. However, although a lot is coming up Aaron Paul these days, the actor is not immune to bad news and recently got some when Netflix announced <em>BoJack Horseman</em> was ending. Now, he’s speaking out about what happened.</p><p>Although <em>BoJack Horseman</em>’s last season had been spun as a decision from the show's creator, in a couple of posts, Aaron Paul shared his emotions over <em>BoJack</em> wrapping, also intimating that perhaps the show’s end wasn’t the rainbows and butterflies ending that had been reported last week. First, he shared his feelings about the ending of the show, also giving fans a look at the Season 6 trailer.</p><div class="see-more see-more--clipped"><blockquote class="twitter-tweet hawk-ignore" data-lang="en"><p lang="en" dir="ltr"><a href="https://twitter.com/cantworkitout/status/1177603258572894208"></a></p></blockquote><div class="see-more__filter"></div></div><p>Aaron Paul later went on to expound on his feelings more in depth, which is <a href="https://twitter.com/aaronpaul_8/status/1177711341819138048">where he noted</a> that he and the creative team had a great time putting together the animated series, which had been one of the streamer’s signature shows through its earliest run of original programming, before seemingly pointing out they would have kept going had they been allowed.</p><div><blockquote><p>We had a wonderful time making Bojack. Couldn’t be more proud. Fell in love with these characters just like everyone else did but sadly Netflix thought it was time to close the curtains and so here we are. They gave us a home for 6 beautiful years. Nothing we could do about it.</p></blockquote></div><p><em>BoJack Horseman</em> made it through Netflix’s early rounds of cancellations and then kept rolling <a href="https://www.cinemablend.com/television/2475976/all-the-netflix-shows-that-have-been-cancelled-in-2019-so-far" data-original-url="https://www.cinemablend.com/television/2475976/all-the-netflix-shows-that-have-been-cancelled-in-2019-so-far">as newer shows started to be axed</a>. Ultimately however, last week Netflix came out to explain that <em>BoJack Horseman</em> will be ending its run sooner rather than later, which was initially a little surprising given that Season 5 of the series had been <a href="https://www.cinemablend.com/television/2457791/bojack-horsemans-best-season-5-episode-is-another-format-breaking-masterpiece" data-original-url="https://www.cinemablend.com/television/2457791/bojack-horsemans-best-season-5-episode-is-another-format-breaking-masterpiece">one of the most highly-rated of the show</a> so far.</p><p>The silver lining was that <em>BoJack Horseman</em> had already previously been announced for Season 6 before Netflix opted to call it quits. So fans would get one more season to wrap up the story.</p><p>It all seems pretty straightforward, but what’s most interesting about Aaron Paul’s reaction is that it doesn’t totally tie in with earlier reports about the show ending. When the news initially broke, <a href="https://www.hollywoodreporter.com/live-feed/bojack-horseman-end-season-6-at-netflix-1243827">THR</a> and other outlets reported that Raphael Bob-Waksberg, the show’s creator, had already planned Season 6 as a conclusion to the story.</p><p>The explanation made sense. After all, Raphael Bob-Waksberg already has a new show heading to Amazon that is also animated. It’s called <em>Undone</em> and <a href="https://www.cinemablend.com/television/2474596/bojack-horseman-creators-new-amazon-show-undone-looks-like-nothing-else-on-tv" data-original-url="https://www.cinemablend.com/television/2474596/bojack-horseman-creators-new-amazon-show-undone-looks-like-nothing-else-on-tv">the first look at the new series</a>, which features <em>Alita: Battle Angel</em>’s Rosa Salazar doing voice work, shows a young girl who is able to manipulate time after a car crash.</p><p><em>BoJack Horseman</em>’s ending was reported as a “creative” decision, and that sort of ending for a series in general is usually more palatable for the fanbase. Now with his “nothing we could do about it” comment, Aaron Paul seems to be indicating the show was cancelled by Netflix and that’s why Season 6 is being planned as the conclusion and not the other way around.</p><p>Early in its original programming run, Netflix was sort of seen as the savior of cancelled shows, <a href="https://www.cinemablend.com/television/2480932/5-netflix-series-to-watch-while-waiting-for-lucifer-season-five" data-original-url="https://www.cinemablend.com/television/2480932/5-netflix-series-to-watch-while-waiting-for-lucifer-season-five">adding projects that originally aired</a> on regular TV like <em>Longmire</em> and <em>Lucifer</em>. In more recent months, it has either ended or cancelled a slew of shows.</p><p>We’re talking about stuff across all kinds of genres. There’s <em>Tuca and Bertie</em>, an animated series that got axed. There’s <em>One Day At A Time</em>, a live-action comedy that was cancelled  <a href="https://www.cinemablend.com/television/2475745/one-day-at-a-time-revived-at-new-network-after-netflix-cancellation" data-original-url="https://www.cinemablend.com/television/2475745/one-day-at-a-time-revived-at-new-network-after-netflix-cancellation">but also later got saved</a> by regular television network Pop. There’s <em>The OA</em>, which <a href="https://www.cinemablend.com/television/2478608/the-oas-brit-marling-addresses-protesting-fans-after-netflixs-shocking-cancellation" data-original-url="https://www.cinemablend.com/television/2478608/the-oas-brit-marling-addresses-protesting-fans-after-netflixs-shocking-cancellation">sparked a lot of fan anger online</a>, given it ended on a cliffhanger.</p><p>Then, of course there are the myriad shows Netflix <a href="https://www.cinemablend.com/television/2474370/the-ranch-cancelled-at-netflix-but-theres-good-news" data-original-url="https://www.cinemablend.com/television/2474370/the-ranch-cancelled-at-netflix-but-theres-good-news">has designated as “ending,”</a> such as <em>The Ranch</em>, <em>GLOW</em>, <a href="https://www.cinemablend.com/television/2466150/fuller-house-is-ending-but-its-not-all-bad-news" data-original-url="https://www.cinemablend.com/television/2466150/fuller-house-is-ending-but-its-not-all-bad-news">and <em>Fuller House</em>.</a></p><p>Ultimately, Netflix is still figuring out its business model in terms of price points, but also just the amount of content it is able to keep up with and get its users to watch. Network and cable TV has had to figure out and face cancellations for years, but watching a whole new medium trying different ways to handle the fanbase has been interesting to say the least.</p><p>Luckily for everyone, the new trend has been for TV shows to be given one more season to wrap things up. That’s what’s happening with <em>BoJack Horseman</em>, here, and then Aaron Paul can move on to pushing his other upcoming TV projects. This ending might be bittersweet, but <a href="https://www.cinemablend.com/television/2457522/westworld-season-3-has-added-aaron-paul" data-original-url="https://www.cinemablend.com/television/2457522/westworld-season-3-has-added-aaron-paul">he’s going to be just fine</a>.</p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ All The Netflix Shows That Have Been Cancelled In 2019 So Far ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/2475976/all-the-netflix-shows-that-have-been-cancelled-in-2019-so-far</link>
                                                                            <description>
                            <![CDATA[ The streaming service with deep pockets has been pretty swift with the axe in 2019. Here's all the bad news that came out so far. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">nmJWMp3eCDCepvsHAar3ph</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/CnGPqCUUM9RJMyXiiWdo9X-1280-80.png" type="image/png" length="0"></enclosure>
                                                                        <pubDate>Thu, 19 Sep 2019 01:01:41 +0000</pubDate>                                                                                                                                <updated>Wed, 02 Oct 2019 18:59:21 +0000</updated>
                                                                                                                                            <category><![CDATA[Streaming News]]></category>
                                                                                                                    <dc:creator><![CDATA[ Nick Venable and Adrienne Jones ]]></dc:creator>                                                                                    <dc:source><![CDATA[ null ]]></dc:source>
                                                                <dc:description><![CDATA[ null ]]></dc:description>
                                                                                                                                <cf:isSponsored>false</cf:isSponsored>
                <cf:hasAffiliateLinks>false</cf:hasAffiliateLinks>
                <cf:isPaid>false</cf:isPaid>
                                                                                                                                <media:content type="image/png" url="https://cdn.mos.cms.futurecdn.net/CnGPqCUUM9RJMyXiiWdo9X-1280-80.png">
                                                            <media:credit><![CDATA[null]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[lucifer]]></media:description>                                                            <media:text><![CDATA[lucifer]]></media:text>
                                <media:title type="plain"><![CDATA[lucifer]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/CnGPqCUUM9RJMyXiiWdo9X-1280-80.png" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="mkQX6fWSYpf6yEDX7msuYE" name="" alt="santa clarita diet" src="https://cdn.mos.cms.futurecdn.net/mkQX6fWSYpf6yEDX7msuYE.png" mos="https://cdn.mos.cms.futurecdn.net/mkQX6fWSYpf6yEDX7msuYE.png" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><p>For a few years after its initial jump into producing TV series, Netflix convinced many subscribers that its original content might live on forever. The fact that both <em>House of Cards</em> and <em>Orange is the New Black</em> only ended in the past 9 months speaks to the company's initial approach to creating signature marquee originals. In 2019, though, all votes are off.</p><p>Netflix is now cancelling its original TV shows at a regular clip, with well over a dozen shows' endings getting confirmed in 2019, for better or worse. (Usually for worse.) Not everything is actually ending in 2019, with some series receiving a final season order to go along with the bad news.</p><p>Here, we've rounded up all of the shows that Netflix has cancelled in 2019, starting off with one of the streaming service's most recognizable TV families.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="zNNNyPP5ujLTsLoH9XnmkW" name="" alt="fuller house" src="https://cdn.mos.cms.futurecdn.net/zNNNyPP5ujLTsLoH9XnmkW.jpg" mos="https://cdn.mos.cms.futurecdn.net/zNNNyPP5ujLTsLoH9XnmkW.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="fuller-house-cancelled-after-5-seasons">Fuller House - Cancelled After 5 Seasons</h2><p>A continuation of the classic TGIF sitcom <em>Full House</em>, <em>Fuller House</em> centered on the families and relationships of Candace Cameron's D.J. Tanner-Fuller, Jodie Sweetin's Stephanie Tanner, and Andrea Barber's Kimmy Gibbler. Netflix announced in January that the show would be <a href="https://www.cinemablend.com/television/2477290/fuller-houses-candace-cameron-bure-is-pretending-the-show-isnt-ending-at-netflix" data-original-url="https://www.cinemablend.com/television/2477290/fuller-houses-candace-cameron-bure-is-pretending-the-show-isnt-ending-at-netflix">ending after Season 5</a>, which is set to debut in late 2019.</p><p><strong>Why Was Fuller House Cancelled Before Season 6?</strong> Though <em>Fuller House</em> has been recognized as a series that a lot of people watched and enjoyed from season to season, the show was hit with a troublesome behind-the-scenes controversy that may have possibly played a part. Creator Jeff Franklin was removed from the series over workplace harassment allegations, which <a href="https://www.cinemablend.com/television/2470428/fuller-house-creator-files-lawsuit-alleging-co-executive-producer-got-him-booted-from-netflix-comedy" data-original-url="https://www.cinemablend.com/television/2470428/fuller-house-creator-files-lawsuit-alleging-co-executive-producer-got-him-booted-from-netflix-comedy">led to a lawsuit</a> that led to some <a href="https://www.cinemablend.com/television/2474938/fuller-house-disturbing-allegations-behind-creator-jeff-franklins-exit-revealed" data-original-url="https://www.cinemablend.com/television/2474938/fuller-house-disturbing-allegations-behind-creator-jeff-franklins-exit-revealed">disturbing details getting reported</a>. (And Franklin's exit happened <em>before</em> Lori Loughlin's college bribery scandal troubles.)</p><p><strong>Could Fuller House Return Somehow?</strong> It's doubtful that <em>Fuller House</em> in its current form will return, but there actually is a more-than-possible chance that the franchise could expand with another spinoff, at least <a href="https://www.cinemablend.com/television/2475533/could-full-house-get-another-spinoff-after-fuller-house-ends-on-netflix" data-original-url="https://www.cinemablend.com/television/2475533/could-full-house-get-another-spinoff-after-fuller-house-ends-on-netflix">according to John Stamos' optimism</a>.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="72rBJ3PA9XjLUx4d28cRHV" name="" alt="travelers" src="https://cdn.mos.cms.futurecdn.net/72rBJ3PA9XjLUx4d28cRHV.png" mos="https://cdn.mos.cms.futurecdn.net/72rBJ3PA9XjLUx4d28cRHV.png" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="travelers-cancelled-after-3-seasons">Travelers - Cancelled After 3 Seasons</h2><p>Initially a Canadian co-production with Netflix, <em>Travelers</em> was a sci-fi drama that featured <em>Will & Grace</em>'s Eric McCormack (who also executive-produced) and others aiming to prevent a post-apocalyptic future. In February of 2019, McCormack revealed on social media that <em>Travelers</em> had been cancelled.</p><p><strong>Why Was Travelers Cancelled Before Season 4?</strong> Netflix was the sole producer of <em>Travelers</em> for its third season, which garnered just as much acclaim, if not more, than those before it when it was released in December. Considering Eric McCormack was everyone's window into the cancellation news, however, it's quite unclear why <em>Travelers</em> ceased production.</p><p><strong>Could Travelers Return Somehow?</strong> Eric McCormack's message at the time stated "Who knows what the future holds?" and also referred to the three Netflix seasons as "Program one, as well call it." So it's not out of the realm of possibilities that another two companies may decide to pair up on it in the future. (<a href="https://www.cinemablend.com/television/2475881/5-sci-fi-tv-shows-to-watch-on-netflix-our-streaming-recommendations" data-original-url="https://www.cinemablend.com/television/2475881/5-sci-fi-tv-shows-to-watch-on-netflix-our-streaming-recommendations">Tell others about it</a>, too.)</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="4A5nHUhKwM63UuzofhZ6aK" name="" alt="jessica jones" src="https://cdn.mos.cms.futurecdn.net/4A5nHUhKwM63UuzofhZ6aK.jpg" mos="https://cdn.mos.cms.futurecdn.net/4A5nHUhKwM63UuzofhZ6aK.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="jessica-jones-cancelled-after-3-seasons">Jessica Jones - Cancelled After 3 Seasons</h2><p>Krysten Ritter's super-powered private detective likes pounding whiskey as much as she likes pounding villains, serving as 1/4 of Netflix's <em>Defenders</em>. But even before Season 3 came out <a href="https://www.cinemablend.com/television/2474871/jessica-jones-season-3-reviews-are-in-heres-what-critics-are-saying" data-original-url="https://www.cinemablend.com/television/2474871/jessica-jones-season-3-reviews-are-in-heres-what-critics-are-saying">to mostly okay reviews</a>, <em>Jessica Jones</em> <a href="https://www.cinemablend.com/television/2467089/jessica-jones-and-the-punisher-cancelled-at-netflix" data-original-url="https://www.cinemablend.com/television/2467089/jessica-jones-and-the-punisher-cancelled-at-netflix">got cancelled</a>, deflating some of the enthusiasm going into the third batch of episodes.</p><p><strong>Why Was Jessica Jones Cancelled Before Season 4?</strong> <em>Jessica Jones</em>' fate was mostly sealed whenever Netflix <a href="https://www.cinemablend.com/television/2477455/would-mike-colter-play-luke-cage-again-after-netflix-cancellation" data-original-url="https://www.cinemablend.com/television/2477455/would-mike-colter-play-luke-cage-again-after-netflix-cancellation">pulled the plug on <em>Luke Cage</em></a> and <em>Iron Fist</em> in late 2018, since it wasn't likely that the company would cancel some of the MCU TV shows and not the rest.</p><p><strong>Could Jessica Jones Return Somehow?</strong> Considering the character is a favorite among Marvel fans, I think it's safe to expect Jessica Jones herself to return in some form in the future. (Don't expect Marvel's Kevin Feige to be too open about it, though <a href="https://www.cinemablend.com/news/2475928/will-we-see-any-marvel-netflix-heroes-in-an-mcu-movie-heres-what-kevin-feige-says" data-original-url="https://www.cinemablend.com/news/2475928/will-we-see-any-marvel-netflix-heroes-in-an-mcu-movie-heres-what-kevin-feige-says">he sounds interested</a>.) It just might not be Krysten Ritter in the leather and denim whenever the P.I. is on the case again.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="UBuSxwphXB2T4LBFtTnoJH" name="" alt="the punisher frank and curtis season 2" src="https://cdn.mos.cms.futurecdn.net/UBuSxwphXB2T4LBFtTnoJH.png" mos="https://cdn.mos.cms.futurecdn.net/UBuSxwphXB2T4LBFtTnoJH.png" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="the-punisher-cancelled-after-2-seasons">The Punisher - Cancelled After 2 Seasons</h2><p>Marvel was big business on Netflix for a time, but that all came crashing down when <em>The Punisher</em> and <em>Jessica Jones</em> got the boot on the same day back in February. <em>The Punisher</em> followed vigilante Frank Castle (Jon Bernthal) as he brought his deadly brand of justice down on gangsters, drug dealers, terrorists and a wide range of baddies, as he held on to a few allies who supported his mission and methods. Sure, <a href="https://www.cinemablend.com/television/2465748/the-punishers-10-most-brutal-season-2-moments-in-gifs" data-original-url="https://www.cinemablend.com/television/2465748/the-punishers-10-most-brutal-season-2-moments-in-gifs">the show was bloody-minded</a>, but you couldn't argue with Frank's results.</p><p><strong>Why Was The Punisher Cancelled Before Season 3?</strong> I suppose we can chalk this up to The Marvel Curse, as all of their Netflix shows were cancelled when it became clear that Disney (which owns all these characters via Marvel) was getting into the streaming business with its own service (Disney+) by the end of 2019.</p><p><strong>Could The Punisher Return Somehow?</strong> Maybe? Here's the complication, there was a clause in all of the contracts for the Marvel shows that stated the characters couldn't be seen in live action for at least two years if their shows were cancelled. So, it's possible that <em>The Punisher</em> could come back, but the question would be when, where and whether or not it would be in the same from that we saw him on Netflix. <a href="https://www.cinemablend.com/television/2467322/eminem-slams-netflix-for-punisher-cancellation-and-jon-bernthal-is-honored" data-original-url="https://www.cinemablend.com/television/2467322/eminem-slams-netflix-for-punisher-cancellation-and-jon-bernthal-is-honored">I bet Eminem can't wait!</a></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="9gmdT4WLAG6qTZxKknUjjZ" name="" alt="friends from college" src="https://cdn.mos.cms.futurecdn.net/9gmdT4WLAG6qTZxKknUjjZ.png" mos="https://cdn.mos.cms.futurecdn.net/9gmdT4WLAG6qTZxKknUjjZ.png" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="friends-from-college-cancelled-after-2-seasons">Friends From College - Cancelled After 2 Seasons</h2><p><em>Friends From College</em> was a show about just that: seven friends (played by Cobie Smulders, Keegan-Michael Key, Annie Parisse, Nat Faxon, Fred Savage, Jae Suh Park and Billy Eichner) who met in college and are trying to navigate their complicated lives and relationships as they enter their forties. Season 2 hit Netflix on January 11, and a little over a month later word came down about the cancellation.</p><p><strong>Why Was Friends From College Cancelled Before Season 3?</strong> It's hard to say, but the show was never any kind of breakout hit, and critics were generally pretty harsh when it came to reviews of <em>Friends From College</em>. The show has been called "underwhelming," the characters "unpleasant" individually and the group as a whole was said to have "sheer charmlessness." Ouch.</p><p><strong>Could Friends From College Return Somehow?</strong> It's probably best to file this one under "will never see new episodes."</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="NbyzHFPoM3S3VmYWEKDP2V" name="" alt="one day at a time" src="https://cdn.mos.cms.futurecdn.net/NbyzHFPoM3S3VmYWEKDP2V.jpg" mos="https://cdn.mos.cms.futurecdn.net/NbyzHFPoM3S3VmYWEKDP2V.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="one-day-at-a-time-cancelled-after-3-seasons">One Day at a Time - Cancelled After 3 Seasons</h2><p>Netflix paired up with TV legend Norman Lear to bring the classic '70s sitcom <em>One Day at a Time</em> into the streaming age, with a Cuban-American family at the center, led by Justina Machado, Isabella Gomez and Rita Moreno. In March of 2019, Netflix cancelled <em>One Day at a Time</em> amidst much hubbub.</p><p><strong>Why Was One Day at a Time Cancelled Before Season 4?</strong> Due to the fan uproar surrounding <em>One Day at a Time</em>'s cancellation, Netflix ended up speaking to the reasoning behind that choice on a few occasions, which boiled down to "financial input > viewership and subscription upticks." While the core fandom was as adoring as could be, it possibly wasn't big on drawing new members in, which Netflix keeps a close eye on.</p><p><strong>Could One Day at a Time Return Somehow?</strong> <em>One Day at a Time</em> is the rare entry on this list that has already locked down a life beyond its cancellation. Though initial attempts to get the show onto CBS All Access were thwarted by a streaming-specific clause in Netflix's contracts, agreements were made for the CBS-owned cable network Pop to be the exclusive home for <em>One Day at a Time</em>'s fourth season, which will likely make its way to CBS All Access at a later date.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="VfNEFuTrn93Rp32iJuMDd7" name="" alt="santa clarita diet" src="https://cdn.mos.cms.futurecdn.net/VfNEFuTrn93Rp32iJuMDd7.jpg" mos="https://cdn.mos.cms.futurecdn.net/VfNEFuTrn93Rp32iJuMDd7.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="santa-clarita-diet-cancelled-after-3-seasons">Santa Clarita Diet - Cancelled After 3 Seasons</h2><p>I think it's safe to say that the history of television has never had a zombie show quite like <em>Santa Clarita Diet</em>. The series, which quickly became known as a zom-com, starred Drew Barrymore and Timothy Olyphant as a married couple who have to deal with her being turned into the prettiest flesh eater y'all ever did see. Season 3 went live on March 29, and less than a month later, Netflix revealed that <a href="https://www.cinemablend.com/television/2470923/netflix-cancelled-santa-clarita-diet-and-timothy-olyphant-had-the-perfect-response" data-original-url="https://www.cinemablend.com/television/2470923/netflix-cancelled-santa-clarita-diet-and-timothy-olyphant-had-the-perfect-response">there would be no Season 4</a>, meaning that <a href="https://www.cinemablend.com/television/2469227/how-santa-clarita-diet-season-3-set-joel-and-sheilas-story-up-for-possible-season-4" data-original-url="https://www.cinemablend.com/television/2469227/how-santa-clarita-diet-season-3-set-joel-and-sheilas-story-up-for-possible-season-4">there were cliffhangers aplenty</a> which would never be answered.</p><p><strong>Why Was Santa Clarita Diet Cancelled Before Season 4?</strong> Netflix hasn't confirmed this, but many of the shows they cancel tend to get the axe after Season 3. <a href="https://deadline.com/2019/04/santa-clarita-diet-canceled-netflix-three-seasons-1202602903/">Deadline</a> has reported that the company's series deals (mainly for shows that the streamer owns) often include bonuses after each season, and while the bonuses are usually pretty reasonable, they can escalate from hundreds of thousands to millions of dollars after Season 3. So, it would seem that <em>Santa Clarita Diet</em> was about to be too expensive.</p><p><strong>Could Santa Clarita Diet Return Somehow?</strong> Not likely, but maybe we'll get a spinoff called <em>Mr. Ball Legs and Friends</em>!</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="NgVxVXiQjyXjGvu62pPBP" name="" alt="the ranch" src="https://cdn.mos.cms.futurecdn.net/NgVxVXiQjyXjGvu62pPBP.png" mos="https://cdn.mos.cms.futurecdn.net/NgVxVXiQjyXjGvu62pPBP.png" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="the-ranch-cancelled-after-4-seasons-8-parts">The Ranch - Cancelled After 4 Seasons (8 Parts)</h2><p><em>The Ranch</em> has never been one of Netflix's biggest hits, but the fact that it starred two actors from the beloved <em>That '70s Sho</em>w (Ashton Kutcher and Danny Masterson) helped it stick around since its beginning in 2016. But, <a href="https://www.cinemablend.com/television/2474370/the-ranch-cancelled-at-netflix-but-theres-good-news" data-original-url="https://www.cinemablend.com/television/2474370/the-ranch-cancelled-at-netflix-but-theres-good-news">Season 4 will be its last</a>, with it airing in two parts across 2019 and 2020.</p><p><strong>Why Was The Ranch Cancelled Before Season 5?</strong> <em>The Ranch</em> started making the wrong kind of news in 2017 when Masterson was accused of sexual assault. He was eventually fired, <a href="https://www.cinemablend.com/television/2388452/netflixs-the-ranch-has-added-a-great-replacement-for-the-fired-danny-masterson" data-original-url="https://www.cinemablend.com/television/2388452/netflixs-the-ranch-has-added-a-great-replacement-for-the-fired-danny-masterson">and replaced by Dax Shepard</a>, but it's possible that the damage was done.</p><p><strong>Could The Ranch Return Somehow?</strong> Right now, that doesn't seem to be an option. But! <em>The Ranch</em> is one of the few Netflix shows to get episode orders that rival network series, so we can expect another 20 episode season, with <a href="https://www.cinemablend.com/television/2478594/netflixs-the-ranch-season-4-trailer-has-another-that-70s-show-reunion-but-no-rooster" data-original-url="https://www.cinemablend.com/television/2478594/netflixs-the-ranch-season-4-trailer-has-another-that-70s-show-reunion-but-no-rooster">10 currently available</a> and another 10 rounding it out in 2020. This means that there's still plenty of <em>The Ranch</em> to be seen before fans have to start relying on a binge re-watch to get their fix.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="CnGPqCUUM9RJMyXiiWdo9X" name="" alt="lucifer" src="https://cdn.mos.cms.futurecdn.net/CnGPqCUUM9RJMyXiiWdo9X.png" mos="https://cdn.mos.cms.futurecdn.net/CnGPqCUUM9RJMyXiiWdo9X.png" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="lucifer-cancelled-after-5-seasons">Lucifer - Cancelled After 5 Seasons</h2><p>The Devil <a href="https://www.cinemablend.com/television/2474883/lucifer-season-4-is-reportedly-crushing-in-binge-views-on-netflix" data-original-url="https://www.cinemablend.com/television/2474883/lucifer-season-4-is-reportedly-crushing-in-binge-views-on-netflix">has been good business for Netflix</a>! After <em>Lucifer</em> got cancelled by Fox to great fan uproar, the streamer came in to save the supernatural procedural which sees Lucifer himself (Tom Ellis) retire to Los Angeles and team up with police detective Chloe Decker (Lauren German) to solve crimes. Season 4 did very well when it debuted in May, and just a few week later it was <a href="https://www.cinemablend.com/television/2474539/lucifers-tom-ellis-will-see-fans-in-hell-for-fifth-and-final-season-on-netflix" data-original-url="https://www.cinemablend.com/television/2474539/lucifers-tom-ellis-will-see-fans-in-hell-for-fifth-and-final-season-on-netflix">renewed for a fifth and final season</a>.</p><p><strong>Why Was Lucifer Cancelled Before Season 6?</strong> It's possible that five seasons was the original plan for <em>Lucifer</em> when the series was developed and the creative team wanted to stick to that. If so, Netflix wisely kept that to itself while waiting to see how Season 4 would fare, and since the show has done so well in its new home, it makes sense that <em>Lucifer</em> would get that final season to wrap it all up.</p><p><strong>Could Lucifer Return Somehow?</strong> Look, we all know you love <em>Lucifer</em>. And, yes, star Ellis is a devilishly hot dude. But, even the show's executive producer has <a href="https://www.cinemablend.com/television/2475836/lucifer-boss-explains-why-fans-shouldnt-push-netflix-for-season-6" data-original-url="https://www.cinemablend.com/television/2475836/lucifer-boss-explains-why-fans-shouldnt-push-netflix-for-season-6">requested that fans not push for more</a>, noting that they were all grateful to get to continue the story at all and give it a fair ending. So, there's probably no luck on this front. You can likely count on <em>Lucifer</em> being on Netflix for years to come, though, so reliving all its former glory will as easy as stepping down as ruler of hell to run a nightclub.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="GGNwajsQPHPRnVHH4Fy6WM" name="" alt="chambers netflix" src="https://cdn.mos.cms.futurecdn.net/GGNwajsQPHPRnVHH4Fy6WM.png" mos="https://cdn.mos.cms.futurecdn.net/GGNwajsQPHPRnVHH4Fy6WM.png" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="chambers-cancelled-after-1-season">Chambers - Cancelled After 1 Season</h2><p>Horror has been having a big renaissance on TV the past several years, and <em>Chambers</em> was an intriguing entry in the field. The series focused on a teenager who survived a heart transplant only to become plagued by visions and "sinister impulses" and a desire to find out everything about the girl she got her new heart from. <em>Chambers</em> had some big names on screen, including Uma Thurman and <a href="https://www.cinemablend.com/television/2432470/scandals-tony-goldwyn-is-heading-to-netflix-for-his-next-big-show" data-original-url="https://www.cinemablend.com/television/2432470/scandals-tony-goldwyn-is-heading-to-netflix-for-his-next-big-show">Tony Goldwyn</a>, but that did not help critical reception.</p><p><strong>Why Was Chambers Cancelled Before Season 2?</strong> As I mentioned above, critics were, overall, not kind to <em>Chambers</em> and the series is listed as 42% rotten on Rotten Tomatoes. Viewers who checked out the show like it a lot more, but I'm guessing that the number of people who decided to watch wasn't that high.</p><p><strong>Could Chambers Return Somehow?</strong> There don't appear to be any plans to try and shop the show around right now, so save your heart some stress and be content with Season 1 until further notice.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="qhBZThrhENv4GckLyz9Szm" name="" alt="rain netflix" src="https://cdn.mos.cms.futurecdn.net/qhBZThrhENv4GckLyz9Szm.png" mos="https://cdn.mos.cms.futurecdn.net/qhBZThrhENv4GckLyz9Szm.png" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="the-rain-cancelled-after-3-seasons">The Rain - Cancelled After 3 Seasons</h2><p>This Danish post-apocalyptic drama focuses on two teens who leave their bunker six years after a rain-carried virus has wiped out most of humanity in Scandinavia. The siblings join another group of survivors, and while they originally think that being released from the rules of society is freeing, they come to find out <a href="https://www.cinemablend.com/television/2408232/5-ways-netflixs-the-rain-is-better-than-most-post-apocalyptic-teen-thrillers" data-original-url="https://www.cinemablend.com/television/2408232/5-ways-netflixs-the-rain-is-better-than-most-post-apocalyptic-teen-thrillers">how difficult life will still be</a>. <em>The Rain</em> got picked up for a third and final season in mid-June.</p><p><strong>Why Was The Rain Cancelled Before Season 4?</strong> No clue on that front right now, but at least fans can look forward to Season 3 sometime next year.</p><p><strong>Could The Rain Return Somehow?</strong> Netflix does not make it easy for their originals to show up elsewhere (especially on competing streaming services), so it's not looking too good for <em>The Rain</em>. But, if <em>One Day at a Time</em> can find a new home, anything is possible.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="juUuhXyJEUW6Dd6qzKP6o4" name="" alt="tuca and bertie human hand" src="https://cdn.mos.cms.futurecdn.net/juUuhXyJEUW6Dd6qzKP6o4.jpg" mos="https://cdn.mos.cms.futurecdn.net/juUuhXyJEUW6Dd6qzKP6o4.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: netflix press)</span></figcaption></figure><h2 id="tuca-and-bertie-cancelled-after-1-season">Tuca And Bertie - Cancelled After 1 Season</h2><p><em>BoJack Horseman</em> is a major hit for Netflix, so giving the creator another anthropomorphic animal comedy probably seemed like a sure thing. Tiffany Haddish (Tuca) and Ali Wong (Bertie) respectively voiced the carefree toucan and anxious songbird besties who navigate life and friendships in their thirties, but it looks like the show did not do well enough for the streamer to re-up its commitment.</p><p><strong>Why Was Tuca And Bertie Cancelled Before Season 2?</strong> Your guess is as good as ours, especially since <em>Tuca and Bertie</em> <a href="https://www.cinemablend.com/television/2470850/8-spectacular-netflix-tv-shows-premiering-may-2019" data-original-url="https://www.cinemablend.com/television/2470850/8-spectacular-netflix-tv-shows-premiering-may-2019">had great reviews</a> and a dedicated fanbase which was prepared to riot when the show got the boot. It's probably safe to assume that the numbers just weren't up to what Netflix was expecting.</p><p><strong>Could Tuca And Bertie Return Somehow?</strong> Funny you should ask. Tiffany Haddish appeared at TCA in early August, just a few days after <em>Tuca and Bertie</em> was cancelled, and said she and creator Lisa Hanawalt had been talking about <a href="https://deadline.com/2019/08/tiffany-haddish-netflix-cancel-tuca-and-bertie-kids-say-the-darndest-things-abc-tca-1202661614/">finding a new home for the animated wonder</a>. So, we'll see what happens!</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="2xYvjW8dw3p439atipKF6L" name="" alt="designated survivor netflix season 3" src="https://cdn.mos.cms.futurecdn.net/2xYvjW8dw3p439atipKF6L.png" mos="https://cdn.mos.cms.futurecdn.net/2xYvjW8dw3p439atipKF6L.png" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: netflix press)</span></figcaption></figure><h2 id="designated-survivor-cancelled-after-3-seasons">Designated Survivor - Cancelled After 3 Seasons</h2><p>Well, here's a show that has survived quite a lot over the past couple of years. <em>Designated Survivor</em> had a breakout Season 1 on ABC, faltered in Season 2 and was then released from that network. But, Netflix swooped in to save the thriller (which starred <a href="https://www.cinemablend.com/television/2477462/how-kiefer-sutherland-responded-to-the-designated-survivor-cancellation-news" data-original-url="https://www.cinemablend.com/television/2477462/how-kiefer-sutherland-responded-to-the-designated-survivor-cancellation-news">Kiefer Sutherland</a> as a low-level politician who becomes president when everyone else in the line of succession above him is killed in a terrorist attack) not long after its cancellation.</p><p><strong>Why Was Designated Survivor Cancelled Before Season 4?</strong> Remember that the drama faltered in the ratings in Season 2? Well, Netflix canned <em>Designated Survivor</em> <a href="https://www.cinemablend.com/television/2477091/designated-survivor-cancelled-again-no-season-4-at-netflix" data-original-url="https://www.cinemablend.com/television/2477091/designated-survivor-cancelled-again-no-season-4-at-netflix">less than two months after Season 3 debuted</a> in full, so it's possible those numbers hadn't rebounded enough to merit more time in Washington.</p><p><strong>Could Designated Survivor Return Somehow?</strong> Seems incredibly unlikely. Most shows still don't get a reprieve after being cancelled once, so the chances of a savior coming along after <em>Designated Survivor</em>'s second go-round? Well, feel free to keep hope alive!</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="pWnmxzHeVUngaBfDCpLbsZ" name="" alt="netflix trinkets" src="https://cdn.mos.cms.futurecdn.net/pWnmxzHeVUngaBfDCpLbsZ.png" mos="https://cdn.mos.cms.futurecdn.net/pWnmxzHeVUngaBfDCpLbsZ.png" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: netflix press)</span></figcaption></figure><h2 id="trinkets-cancelled-after-2-seasons">Trinkets - Cancelled After 2 Seasons</h2><p>Teen drama <em>Trinkets</em>, which is based on Kirsten “Kiwi” Smith‘s young adult novel of the same name, has built a following, but not enough for Netflix to keep it around. The series, which focuses on three young women from different high school social strata who bond in Shoplifters Anonymous, was renewed for Season 2, which was announced to be its last.</p><p><strong>Why Was Trinkets Cancelled Before Season 3?</strong> No specifics for the cancellation have been given (no shock there), but it's possible that it might just boil down to <em>Trinkets</em> not getting enough viewers, and / or Netflix wanting to spend their <em>Trinkets</em> cash on something else that might capture public attention better.</p><p><strong>Could Trinkets Return Somehow?</strong> The 10 episode Season 2 will hit the streamer sometime in 2020, and, currently, it looks like that will be all she wrote for <em>Trinkets</em>. But, at least the writers have time to craft an actual finale for the series.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="e55LukDmbfBdMiS7aThmKE" name="" alt="13 reasons why courtroom" src="https://cdn.mos.cms.futurecdn.net/e55LukDmbfBdMiS7aThmKE.png" mos="https://cdn.mos.cms.futurecdn.net/e55LukDmbfBdMiS7aThmKE.png" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: netflix press)</span></figcaption></figure><h2 id="13-reasons-why-cancelled-after-4-seasons">13 Reasons Why - Cancelled After 4 Seasons</h2><p>While many critics and audiences praised the way <em>13 Reasons Why</em> dealt with difficult subject matter like suicide, rape and school shootings, the show, which began as a study of why student Hannah Baker (Katherine Langford) killed herself, has also brought ire from many for examining those very same topics. When it was renewed for Season 4 in August 2019, it was also announced that it would be its last.</p><p><strong>Why Was 13 Reasons Why Cancelled Before Season 5?</strong> Netflix hasn't cited a reason, but there are three possibilities. The controversy surrounding the series may have helped the decision along, as the show was cancelled less than a month after Netflix edited out the very controversial scene from Season 1 where Hannah actually commits suicide. Meanwhile, Season 3 was released to <a href="https://heavy.com/entertainment/2019/08/13-reasons-why-season-3-narrator-ani/">surprisingly negative reviews</a>, which probably didn't help matters. But, Season 4 is said to deal with the main characters graduating from high school, so it's also possible that it just seemed like the best time to wrap up the story.</p><p><strong>Could 13 Reasons Why Return Somehow?</strong> This is unlikely. As of right now, there's been no word on the show being shopped elsewhere, plus, as mentioned earlier, the main characters will be <a href="https://www.cinemablend.com/news/2479111/who-might-play-little-mermaids-eric-now-that-harry-styles-is-out" data-original-url="https://www.cinemablend.com/news/2479111/who-might-play-little-mermaids-eric-now-that-harry-styles-is-out">graduating from high school this season</a>, so it would seem that the storylines will be wrapped up at the end of Season 4.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="z3xqVJSkCGEewQ9dTnKt5T" name="" alt="she's gotta have it dewanda wise on the ocean" src="https://cdn.mos.cms.futurecdn.net/z3xqVJSkCGEewQ9dTnKt5T.png" mos="https://cdn.mos.cms.futurecdn.net/z3xqVJSkCGEewQ9dTnKt5T.png" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: netflix press)</span></figcaption></figure><h2 id="she-39-s-gotta-have-it-cancelled-after-2-seasons">She's Gotta Have It - Cancelled After 2 Seasons</h2><p>Spike Lee's re-visioning of the story he told in his very first film, <em>She's Gotta Have It</em> followed free-spirited artist Nola Darling (DeWanda Wise) as she struggled to stay true to her dreams while splitting her time between friends, family and three lovers. <a href="https://www.cinemablend.com/television/1727899/shes-gotta-have-it-review-spike-lees-netflix-series-is-a-stunner" data-original-url="https://www.cinemablend.com/television/1727899/shes-gotta-have-it-review-spike-lees-netflix-series-is-a-stunner">Positive reception from critics</a> and audiences alike didn't stop the show from being cancelled a couple of months after the second season hit Netflix.</p><p><strong>Why Was She's Gotta Have It Cancelled Before Season 3?</strong> There's no word on that right now, but Netflix chief content officer Ted Sarandos did say that they were "thrilled" Spike Lee brought the show to them and "very proud" that it will be available there "for years to come."</p><p><strong>Could She's Gotta Have It Return Somehow?</strong> Possibly? Word from <a href="https://deadline.com/2019/07/shes-gotta-have-it-canceled-two-seasons-netflix-1202648170/">Deadline</a> when the show was cancelled in mid-July 2019 said that it was expected that Spike Lee would shop it elsewhere, but we don't currently know if that's being done or if any other networks or streamers are interested.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="YMqJVanGwA7dNUXWhGpofH" name="" alt="jane fonda lily tomlin grace and frankie netflix" src="https://cdn.mos.cms.futurecdn.net/YMqJVanGwA7dNUXWhGpofH.jpg" mos="https://cdn.mos.cms.futurecdn.net/YMqJVanGwA7dNUXWhGpofH.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="grace-and-frankie-cancelled-after-7-seasons">Grace And Frankie - Cancelled After 7 Seasons</h2><p>While a <em>9 to 5</em> sequel / reboot has not been forthcoming, <em>Grace and Frankie</em> managed to bring back 2/3 of the dynamic on screen team featured in that classic comedy for another go-round. Grace (Jane Fonda) and Frankie (Lily Tomlin) are long time rivals whose husbands are business partners. But, when their husbands break the news to the ladies that they are actually in love with each other, well, most bickering comes to a halt as <em>Grace and Frankie</em> figure out how to move on with their lives.</p><p><strong>Why Was Grace And Frankie Cancelled Before Season 8?</strong> When <em>Grace and Frankie</em> was renewed for Season 7 just a few days ago, meaning that it will become the longest-running Netflix original, it was also announced that <a href="https://www.cinemablend.com/television/2479128/netflixs-orange-is-the-new-black-wont-be-its-longest-running-series-for-much-longer" data-original-url="https://www.cinemablend.com/television/2479128/netflixs-orange-is-the-new-black-wont-be-its-longest-running-series-for-much-longer">this record-breaking season would be its last</a>. Netflix hasn't revealed why the series has gotten the axe, but <em>Grace and Frankie</em> <a href="https://www.cinemablend.com/television/2476666/netflix-users-favorite-show-may-surprise-you-its-not-stranger-things" data-original-url="https://www.cinemablend.com/television/2476666/netflix-users-favorite-show-may-surprise-you-its-not-stranger-things">has legions of fans</a> and has been nominated for 11 Emmys and six Screen Actors Guild awards, so it's good that the writers will get a chance to give viewers a satisfying ending.</p><p><strong>Could Grace And Frankie Return Somehow?</strong> Right now, the chances are slim. Stars Jane Fonda and Lily Tomlin put out a statement about the cancellation, along with co-creators Marta Kauffman and Howard J. Harris putting out one of their own, which made the ending seem pretty definitive.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="iEAtN9EYQJPZKjngmvowrh" name="" alt="the oa brit marling" src="https://cdn.mos.cms.futurecdn.net/iEAtN9EYQJPZKjngmvowrh.png" mos="https://cdn.mos.cms.futurecdn.net/iEAtN9EYQJPZKjngmvowrh.png" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="the-oa-cancelled-after-2-seasons">The OA - Cancelled After 2 Seasons</h2><p><em>The OA</em> was definitely an under the radar series, but it absolutely had its dedicated fans. The genre-bending show featured Brit Marling (who also co-created and executive produced) as a blind woman who went missing seven years previously showing up alive, but now able to see and with a wild story to tell about her time away. Instead of talking to police or her parents, though, she recruits locals and asks for their help in locating other missing people. Season 2 debuted on March 22, and <a href="https://www.cinemablend.com/television/2477600/the-oa-creator-responds-after-it-becomes-the-latest-series-to-be-cancelled-by-netflix" data-original-url="https://www.cinemablend.com/television/2477600/the-oa-creator-responds-after-it-becomes-the-latest-series-to-be-cancelled-by-netflix">the cancellation came in early August</a>.</p><p><strong>Why Was The OA Cancelled Before Season 3?</strong> Well, it sounds like a case of the show getting to the point where it was going to be too expensive considering the number of viewers it had, but that, obviously, hasn't been confirmed by Netflix. But, it should also be noted that fans were <em>beyond</em> super pissed that <em>The OA</em> got cancelled, and <a href="https://twitter.com/savetheoaperiod/status/1171196696870752256">mobilized a #CancelNetflix movement</a> to protest not just this cancellation but the cancellation of basically every other show that has ever been cancelled by Netflix. Oh, well.</p><p><strong>Could The OA Return Somehow?</strong> Doubtful, <a href="https://www.cinemablend.com/television/2478869/the-oa-wont-be-getting-a-series-finale-movie-at-netflix" data-original-url="https://www.cinemablend.com/television/2478869/the-oa-wont-be-getting-a-series-finale-movie-at-netflix">at least anytime soon</a>. Like many of the shows on this list, <em>The OA</em> was exclusive to Netflix and the idea of the company selling its rights are quite slim. But, again, <em>One Day at a Time</em> was released, so it's not impossible.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="CyZVLmgXqCEg6KX3icVNkH" name="" alt="no good nick" src="https://cdn.mos.cms.futurecdn.net/CyZVLmgXqCEg6KX3icVNkH.png" mos="https://cdn.mos.cms.futurecdn.net/CyZVLmgXqCEg6KX3icVNkH.png" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="no-good-nick-cancelled-after-1-season">No Good Nick - Cancelled After 1 Season</h2><p>Sean Astin <a href="https://www.cinemablend.com/television/2470415/how-stranger-things-and-bob-newby-impacted-sean-astins-new-netflix-show" data-original-url="https://www.cinemablend.com/television/2470415/how-stranger-things-and-bob-newby-impacted-sean-astins-new-netflix-show">made quite an impact</a> when he showed up on Season 2 of <em>Stranger Things</em>, and he was able to <a href="https://www.cinemablend.com/television/2458100/stranger-things-sean-astin-has-another-netflix-show-on-the-way-with-melissa-joan-hart" data-original-url="https://www.cinemablend.com/television/2458100/stranger-things-sean-astin-has-another-netflix-show-on-the-way-with-melissa-joan-hart">turn that into a starring role</a> on <em>No Good Nick</em> alongside Melissa Joan Hart. They played parents Liz and Ed Thompson, who welcome 13-year-old Nicole (a.k.a. Nick) into their home thinking she's a long lost family member in need. But, it turns out that Nick has really been sent there by her imprisoned dad to get revenge on the Thompson's for a supposed wrong they did to him. The 20 episode first season aired in two parts and the series was cancelled in mid-September.</p><p><strong>Why Was No Good Nick Cancelled Before Season 2?</strong> Because so many Netflix cancellations come after Season 2 or 3, it's probably pretty safe to assume that <em>No Good Nick</em> <a href="https://www.cinemablend.com/television/2480308/netflix-cancelled-melissa-joan-hart-sean-astin-no-good-nick-show-after-one-season" data-original-url="https://www.cinemablend.com/television/2480308/netflix-cancelled-melissa-joan-hart-sean-astin-no-good-nick-show-after-one-season">just didn't resonate with audiences enough</a> to merit another round of episodes.</p><p><strong>Could No Good Nick Return Somehow?</strong> Unfortunately, there doesn't seem to be any plan to find a new home for <em>No Good Nick</em>, so it looks like Season 1 will have to suffice.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="2URatVg9snZSuLZcgSsLDm" name="" alt="glow season 3" src="https://cdn.mos.cms.futurecdn.net/2URatVg9snZSuLZcgSsLDm.png" mos="https://cdn.mos.cms.futurecdn.net/2URatVg9snZSuLZcgSsLDm.png" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="glow-cancelled-after-season-4">GLOW - Cancelled After Season 4</h2><p>Fans of the Gorgeous Ladies of Wrestling are saddened after the show about female wrestlers, Hollywood misfits and everything that grinds and glitters in the 1980s was cancelled in late September. <em>GLOW</em> focused on struggling actress Ruth Wilder (Alison Brie), who finds another shot at stardom by becoming a women's professional wrestler. The series has mostly been a critical hit, with 15 Emmy nominations and three wins across the first three seasons.</p><p><strong>Why Was Glow Cancelled Before Season 5?</strong> You know Netflix isn't going to give that info up easily, but this is in line with what we've been seeing from the streamer with many of its cancellations. It's possible <em>GLOW</em> was about to become too expensive for them to continue standing behind it.</p><p><strong>Could Glow Return Somehow?</strong> This doesn't feel likely right now, but the good news is that <a href="https://www.cinemablend.com/television/2477085/11-awesome-netflix-originals-premiering-in-august-2019" data-original-url="https://www.cinemablend.com/television/2477085/11-awesome-netflix-originals-premiering-in-august-2019">Season 3 just hit Netflix in August</a> and Season 4 is due in 2020, so fans have a while before they have to live without any hope of new <em>GLOW</em>.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="JYPULEUHjggEtEidjqPv6g" name="" alt="bojack horseman season 6" src="https://cdn.mos.cms.futurecdn.net/JYPULEUHjggEtEidjqPv6g.png" mos="https://cdn.mos.cms.futurecdn.net/JYPULEUHjggEtEidjqPv6g.png" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="bojack-horseman-cancelled-after-season-6">BoJack Horseman - Cancelled After Season 6</h2><p>Well, folks, this is it. The animated show about an anthropomorphic, has-been, Hollywood actor horse who's drowning in booze and self-loathing has come to the end of its road. The highly acclaimed series, which stars the voices of Will Arnett, Alison Brie, Aaron Paul, Amy Sedaris and others, has often been hailed as a funny and subversive look at some pretty emotional topics, but Season 6 of <em>BoJack Horseman</em>, which begins later in 2019, will be the end.</p><p><strong>Why Was BoJack Horseman Cancelled Before Season 7?</strong> Alright, here's where things get a bit tricky. When news of the cancellation came down in late September 2019, it was originally reported that series creator Raphael Bob-Waksberg had created Season 6 as the conclusion to the long-running story, making the end seem like the show's decision. But, a few days later, <em>BoJack</em> <a href="https://www.cinemablend.com/television/2481223/why-is-netflixs-bojack-horseman-ending-aaron-paul-seems-to-have-a-different-explanation" data-original-url="https://www.cinemablend.com/television/2481223/why-is-netflixs-bojack-horseman-ending-aaron-paul-seems-to-have-a-different-explanation">star Aaron Paul took to social media</a> and said, in part, "sadly Netflix thought it was time to close the curtains and so here we are...Nothing we could do about it." Well, that doesn't sound so simple, does it?</p><p><strong>Could BoJack Horseman Return Somehow?</strong> As with most of the shows on this list, Season 7 of <em>BoJack Horseman</em> is unlikely to happen anywhere. But, Season 6 will air in two parts, beginning October 25 for Part 1 and wrapping up with Part 2 on January 31, 2020, so there's a lot of <em>BoJack</em> left to be had for disappointed fans.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="z8fvNuYRuYCyDXTJ8WqDRa" name="" alt="dear white people" src="https://cdn.mos.cms.futurecdn.net/z8fvNuYRuYCyDXTJ8WqDRa.png" mos="https://cdn.mos.cms.futurecdn.net/z8fvNuYRuYCyDXTJ8WqDRa.png" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="dear-white-people-cancelled-after-season-4">Dear White People - Cancelled After Season 4</h2><p>The critically acclaimed show, based on the 2014 indie film of the same name, follows a group of black students at a mostly white Ivy League university where racial tensions are always brewing just under the surface. <em>Dear White People</em>, which stars Logan Browning, Marque Richardson, DeRon Horton and Brandon P. Bell (among many others), was praised for using humor, honesty, irony and self-deprecation to put a spotlight on racial issues, and will get one more season to give fans a well-deserved conclusion.</p><p><strong>Why Was Dear White People Cancelled Before Season 5?</strong> You probably know what I'm going to say by now, right? We're not sure and Netflix isn't talking. But, creator Justin Simien doesn't seem miffed by the cancellation at all, and thanked the streamer for giving him a chance to continue the story he began in his film and noted that he was planning "a celebratory final volume befitting such a transformative experience," to wrap up the series.</p><p><strong>Could Dear White People Return Somehow?</strong> It's not likely at this point, especially considering the fact that Simien seems more than ready to finish off his story. Luckily, though, there will be 10 episodes for fans to feast their eyes on when Season 4 finally debuts. Try not to binge them all in one day!</p><p>That, for now, is the list of current cancellations by Netflix. But, if the bloodbath continues you can be sure that we'll update this guide so that you can keep up to date on whether or not your favorite shows will be returning.</p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ Hulu Reveals Its 3 Favorite Netflix Shows And Wants Netflix To Play Along ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/2475022/hulu-reveals-its-3-favorite-netflix-shows-and-wants-netflix-to-play-along</link>
                                                                            <description>
                            <![CDATA[ Hulu has revealed its Netflix favorites! ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">wv7BTXNwf8EAxZug2AjdRN</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/6iYJb6nVHByfjxa7y9yKcP-1280-80.png" type="image/png" length="0"></enclosure>
                                                                        <pubDate>Fri, 14 Jun 2019 01:47:50 +0000</pubDate>                                                                                                                                                                                                                                <category><![CDATA[Television]]></category>
                                                                                                                    <dc:creator><![CDATA[ Britt Lawrence ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/nZc7U9xPWeMriqycZdeEEo.png ]]></dc:source>
                                                                <dc:description><![CDATA[ null ]]></dc:description>
                                                                                                                                <cf:isSponsored>false</cf:isSponsored>
                <cf:hasAffiliateLinks>false</cf:hasAffiliateLinks>
                <cf:isPaid>false</cf:isPaid>
                                                                                                                                <media:content type="image/png" url="https://cdn.mos.cms.futurecdn.net/6iYJb6nVHByfjxa7y9yKcP-1280-80.png">
                                                            <media:credit><![CDATA[Netflix]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[Stranger Things David Harbour Chief Hopper Netflix]]></media:description>                                                            <media:text><![CDATA[Stranger Things David Harbour Chief Hopper Netflix]]></media:text>
                                <media:title type="plain"><![CDATA[Stranger Things David Harbour Chief Hopper Netflix]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/6iYJb6nVHByfjxa7y9yKcP-1280-80.png" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="6iYJb6nVHByfjxa7y9yKcP" name="" alt="Stranger Things David Harbour Chief Hopper Netflix" src="https://cdn.mos.cms.futurecdn.net/6iYJb6nVHByfjxa7y9yKcP.png" mos="https://cdn.mos.cms.futurecdn.net/6iYJb6nVHByfjxa7y9yKcP.png" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: Netflix)</span></figcaption></figure><p>When it comes to the world of streaming, things are <a href="https://www.cinemablend.com/television/2458434/netflix-and-amazon-are-aiming-to-double-their-original-programming-output" data-original-url="https://www.cinemablend.com/television/2458434/netflix-and-amazon-are-aiming-to-double-their-original-programming-output?pv=search">pretty competitive</a>. That is why it is nice to see streaming giants have a little fun with each other. It turns out, they are a fan of each other’s work too. Or at least, Hulu admits that it is.</p><p>Taking questions from Twitter, Hulu asked users to ask about its “top three anything.” User <a href="https://twitter.com/charlieridgely/status/1139232625741238272">Charlie Ridgley</a> seized the moment by asking what its top three Netflix originals are. Hulu responded with an answer! Check out the picks below, which include a challenge for Netflix to return the favor:</p><div class="see-more see-more--clipped"><blockquote class="twitter-tweet hawk-ignore" data-lang="en"><p lang="en" dir="ltr"><a href="https://twitter.com/cantworkitout/status/1139236663257780224"></a></p></blockquote><div class="see-more__filter"></div></div><p>This is an interesting top three! You have a bit of everything. The one thing that #1 and #3 have in common is both being sci-fi series. Otherwise, this is a top three that showcases three distinct entries.</p><p>In third place is Netflix’s sci-fi series, <em>Stranger Things</em>. Hulu must be excited for Season 3! Although, probably a little nervous about what is to come out of it. David Harbour teased the end of Season 3 in <a href="https://www.cinemablend.com/television/2474162/stranger-things-david-harbour-says-season-3s-end-is-unexpected-and-very-very-moving" data-original-url="https://www.cinemablend.com/television/2474162/stranger-things-david-harbour-says-season-3s-end-is-unexpected-and-very-very-moving">a very thought-provoking way</a>.</p><p>Will it <a href="https://www.cinemablend.com/television/2474185/will-stranger-things-season-3-kill-off-a-major-character" data-original-url="https://www.cinemablend.com/television/2474185/will-stranger-things-season-3-kill-off-a-major-character">kill off a major character</a>? Hulu and others will have to brace themselves. Finn Wolfhard feels like Season 3 <a href="https://www.cinemablend.com/television/2474891/why-stranger-things-finn-wolfhard-thinks-season-3-works-better-than-the-first-two" data-original-url="https://www.cinemablend.com/television/2474891/why-stranger-things-finn-wolfhard-thinks-season-3-works-better-than-the-first-two">works better</a> than its previous ones. Fans, which include Hulu, will have to see if they agree.</p><p>Taking second place on Hulu’s Top 3 is the animated adult dramedy, <em>BoJack Horseman</em>. The show, which features the voices of Will Arnett and Amy Sedaris, is also heading back for another season. It will be entering its sixth. <em>BoJack Horseman</em> follows its titular character, an anthropomorphic horse.</p><p>BoJoack deals with his share of self-loathing on the series, all the while trying to navigate the entertainment industry. Hulu is in good company in lauding the show. CinemaBlend’s own Nick Venable is <a href="https://www.cinemablend.com/television/2464282/the-10-best-tv-shows-of-2018-according-to-nick" data-original-url="https://www.cinemablend.com/television/2464282/the-10-best-tv-shows-of-2018-according-to-nick">also a fan</a>.</p><p>Then there is number one on Hulu’s list – <em>Black Mirror</em>. The sci-fi series has been a critical and fan favorite ever since its debut. Interestingly, <em>Black Mirror</em> originated on Britain’s Channel 4 before coming to Netflix, but the show has been there since Season 3.</p><p>Hulu is standing by <em>Black Mirror</em> in a major way by having it top its list despite a <a href="https://www.cinemablend.com/television/2474523/black-mirror-the-biggest-problems-with-season-5-according-to-critics" data-original-url="https://www.cinemablend.com/television/2474523/black-mirror-the-biggest-problems-with-season-5-according-to-critics">divisive fifth season</a>. Are their favorite episodes the same as CinemaBlend’s Gina Carbone? She shared her picks for <a href="https://www.cinemablend.com/television/2474549/the-10-best-black-mirror-episodes-including-season-5" data-original-url="https://www.cinemablend.com/television/2474549/the-10-best-black-mirror-episodes-including-season-5">the best episodes</a>, including Season 5. Fans will have to stay tuned to learn if it will <a href="https://www.cinemablend.com/television/2474917/will-there-be-a-black-mirror-season-6-on-netflix" data-original-url="https://www.cinemablend.com/television/2474917/will-there-be-a-black-mirror-season-6-on-netflix">return for a sixth</a>. Hulu might want to be the first to know!</p><p>As of this story’s publication, Netflix’s official Twitter handle has yet to answer Hulu’s challenge. There is a lot for the streaming giant to choose from. Maybe they are waiting for the <a href="https://www.cinemablend.com/television/2474874/why-veronica-mars-couldnt-get-too-hardcore-with-adult-content-on-hulu" data-original-url="https://www.cinemablend.com/television/2474874/why-veronica-mars-couldnt-get-too-hardcore-with-adult-content-on-hulu">not-too-adult</a> <em>Veronica Mars</em> revival to arrive before commenting. This June is a busy month for Hulu with the return of <em>The Handmaid’s Tale</em>, <a href="https://www.cinemablend.com/television/2471828/hulu-new-releases-movies-and-tv-shows-streaming-in-june-2019" data-original-url="https://www.cinemablend.com/television/2471828/hulu-new-releases-movies-and-tv-shows-streaming-in-june-2019">among others</a>.</p><p>You can join Hulu in binge-watching <em>Stranger Things</em> when Season 3 arrives Thursday, July 4 on Netflix. The first five seasons of <em>Black Mirror</em> (including <em>Bandersnatch</em>) and <em>BoJack Horseman</em> are currently streaming. Whether you are watching Hulu or what Netflix has to offer <a href="https://www.cinemablend.com/television/2462989/2019-netflix-premiere-schedule-dates-for-new-and-returning-shows" data-original-url="https://www.cinemablend.com/television/2462989/2019-netflix-premiere-schedule-dates-for-new-and-returning-shows">the rest of the year</a>, summer will be hot when it comes to <a href="https://www.cinemablend.com/television/2469307/2019-summer-tv-and-streaming-schedule-premiere-dates-for-new-and-returning-shows" data-original-url="https://www.cinemablend.com/television/2469307/2019-summer-tv-and-streaming-premiere-dates-for-new-and-returning-shows">television premieres</a>.</p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ The 10 Best TV Shows Of 2018, According To Nick ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/2464282/the-10-best-tv-shows-of-2018-according-to-nick</link>
                                                                            <description>
                            <![CDATA[ 2018 wasn't the best year for yours truly, but things were pretty amazing on the TV side of things. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">3J1UPk2ARxX32HBcdXyHBp</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/zAVG6rRKfrQ4mLMFEMGuiV-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Wed, 02 Jan 2019 23:02:29 +0000</pubDate>                                                                                                                                <updated>Thu, 03 Jan 2019 01:32:52 +0000</updated>
                                                                                                                                            <category><![CDATA[Television]]></category>
                                                                                                                    <dc:creator><![CDATA[ Nick Venable ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/TzeQjfZT5cKqHRsEqudtqT.png ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Nick Venable is an Assistant Managing Editor, and the TV Editor. His humble origin story with CinemaBlend began all the way back in the pre-streaming era, circa 2009, as a freelancing DVD reviewer and TV recapper. After rising up through the ranks covering Movies, Nick leapfrogged over to the small screen to cover more and more television news and interviews, eventually taking over the section for the current era. Born in Louisiana and currently living in Texas — Who Dat Nation over America’s Team all day, all night — Nick spent several years in the hospitality industry, and also worked as a 911 operator. And if you ever happened to hear his music or read his comics/short stories, you have his sympathy.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What He&#039;s Into&lt;/strong&gt;: Nick is one of those people who won’t necessarily insert a Monty Python reference into every conversation, but is still mentally equipped to do so. Beyond such appreciation for surreal UK comedy, Nick also indulges in as much horror splendor as possible, from Stephen King novels to James Tynion IV comics to Freddy Krueger one-liners to all things Mike Flanagan. Throw in a dash of NFL, some 311 and Weird Al, fried crawfish poboys, bourbon, ‘90s-era pro wrestling, crossword puzzles and mystery-driven video games, and baby, you got a stew going. (Nick will insert an Arrested Development reference into every conversation, if possible.)&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What He&#039;s Excited About&lt;/strong&gt;: Anything Jeff Lemire, Tom King and W. Maxwell Prince think of, ever. More of Kelly Reilly’s deliriously fierce performances on Yellowstone. HBO’s The Last of Us. Clone High’s return. Colin Farrell’s Penguin being in every movie/TV show/breakfast cereal.&lt;/p&gt; ]]></dc:description>
                                                                                                                                <cf:isSponsored>false</cf:isSponsored>
                <cf:hasAffiliateLinks>false</cf:hasAffiliateLinks>
                <cf:isPaid>false</cf:isPaid>
                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/zAVG6rRKfrQ4mLMFEMGuiV-1280-80.jpg">
                                                            <media:credit><![CDATA[hbo press site]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[westworld dolores at the piano]]></media:description>                                                            <media:text><![CDATA[westworld dolores at the piano]]></media:text>
                                <media:title type="plain"><![CDATA[westworld dolores at the piano]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/zAVG6rRKfrQ4mLMFEMGuiV-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>The already vast number of scripted TV series <a href="https://www.cinemablend.com/television/2463527/streaming-tv-shows-outnumber-broadcast-and-cable-series-for-the-first-time" data-original-url="https://www.cinemablend.com/television/2463527/streaming-tv-shows-outnumber-broadcast-and-cable-series-for-the-first-time">grew larger than ever</a> in 2018, for a total somewhere north of 550 different shows. The vastness of that selection is both glorious and damning, of course, especially for someone whose job partially relies on watching as many different shows as possible. As such, this was the year when I fully accepted how impossible it can be to give every new and returning TV show a chance to wow me.</p><p>For yours truly, 2018 was also staunchly marked by loss and grief, adding to the strain of indulging in the biggest highlights in streaming and primetime TV. Admittedly, I avoided some of the dark and depressing dramas that usually serve as objects of my obsession, though many still snuck by. I was absolutely grateful that 2018 was another fantastic year for blacker-than-black comedies, which are generally comfort food for my sanity. So let's reflect on the ten TV series that hit me the hardest in the past year.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="3AyuuLkG4ZdCojRukKhMuH" name="" alt="arrested development tobias in the banana suit" src="https://cdn.mos.cms.futurecdn.net/3AyuuLkG4ZdCojRukKhMuH.jpg" mos="https://cdn.mos.cms.futurecdn.net/3AyuuLkG4ZdCojRukKhMuH.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="10-arrested-development-netflix">10. Arrested Development - Netflix</h2><p>Watching the first half of <em>Arrested Development</em>'s long-awaited fifth season, it was almost impossible not to view it through the prism of Season 4's disjointedness and the disturbing allegations and stories about <a href="https://www.cinemablend.com/television/2431699/arrested-developments-creator-spoke-up-about-jessica-walter-and-jeffrey-tambor" data-original-url="https://www.cinemablend.com/television/2431699/arrested-developments-creator-spoke-up-about-jessica-walter-and-jeffrey-tambor">Jeffrey Tambor's</a> behavior on this show and <a href="https://www.cinemablend.com/television/2313222/jeffrey-tambor-went-off-on-amazon-over-transparent-firing" data-original-url="https://www.cinemablend.com/television/2313222/jeffrey-tambor-went-off-on-amazon-over-transparent-firing">on Amazon's <em>Transparent</em></a>. All that said, Season 5 was still pretty damned hilarious through many of the half-season's meandering plots.</p><p>Because the whole gang finally got back together for roughly the whole season, and because much of the previous season's weird plotting got course-corrected, and because I love these characters so damned much, <em>Arrested Development</em> hand-hooked its way into my Top 10. I <em>wonder</em> what the next half-season will be like. [Tony Wonder pops out from behind my couch.]</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="CDhm8NbMkX8b6uGZBXpuLZ" name="" alt="forever maya rudolph amazon" src="https://cdn.mos.cms.futurecdn.net/CDhm8NbMkX8b6uGZBXpuLZ.png" mos="https://cdn.mos.cms.futurecdn.net/CDhm8NbMkX8b6uGZBXpuLZ.png" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="9-forever-amazon">9. Forever - Amazon</h2><p>Talk about undersung gems. Alan Yang and Matt Hubbard's genre-bending <em>Forever</em> is the dauntingly imaginative and insightfully neurotic look at death that way too many people slept on. Had <em>Forever</em>'s biggest draws only been its heightened narrative, its string of episodic twists, and its co-leads in Maya Rudolph and Fred Armisen, it might have still made this list.</p><p>However, <em>Forever</em>'s biggest weapon is the ever-present humanity in what is ostensibly a character study of a woman discovering she's no longer content with her stagnant marriage and lifestyle. Armisen is great, as are recurring stars Catherine Keener and Noah Robbins, but Maya Rudolph's shell-dropping June is a character that'll remain in my heart for a long time.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="HvpYt84v8532rmq2vS7nVd" name="" alt="sharp objects camille and adora" src="https://cdn.mos.cms.futurecdn.net/HvpYt84v8532rmq2vS7nVd.jpg" mos="https://cdn.mos.cms.futurecdn.net/HvpYt84v8532rmq2vS7nVd.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="8-sharp-objects-hbo">8. Sharp Objects - HBO</h2><p>Despite being one of the greatest TV offerings of 2018, <em>Sharp Objects</em> is a harsh pill to swallow. (Well, not a pill exactly...) It's a story about murder, obsession, dysfunction, and a small town that could no longer hold back its darkest secrets. Also potentially crooked cops, the perils of crime journalism, the undying hunt for attention and so on.</p><p>Amy Adams, Patricia Clarkson and <a href="https://www.cinemablend.com/television/2455587/why-sharp-objects-amma-is-so-uncomfortable-to-watch-according-to-the-star" data-original-url="https://www.cinemablend.com/television/2455587/why-sharp-objects-amma-is-so-uncomfortable-to-watch-according-to-the-star">Eliza Scanlen</a> deliver the meatiest performances in this quick-moving thriller, demanding full attention among a stellar cast of TV and film vets. Series director Jean-Marc Vallée and the masterful editing are what vaults <em>Sharp Objects</em> over the top, though, by enclosing audiences squarely within Camille's fractured headspace through this entire sordid affair.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="zAVG6rRKfrQ4mLMFEMGuiV" name="" alt="westworld dolores at the piano" src="https://cdn.mos.cms.futurecdn.net/zAVG6rRKfrQ4mLMFEMGuiV.jpg" mos="https://cdn.mos.cms.futurecdn.net/zAVG6rRKfrQ4mLMFEMGuiV.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: hbo press site)</span></figcaption></figure><h2 id="7-westworld-hbo">7. Westworld - HBO</h2><p>The waiting between <em>Westworld</em> seasons felt like a lifetime, and then Season 2 dropped three lifetimes (timelines?) worth of off-kilter developments that continued gnawing at me long after watching. Though I understand that <em>Westworld</em> tries to be too smart for its own good by somewhat arbitrarily <a href="https://www.cinemablend.com/television/2449360/westwoods-evan-rachel-wood-was-completely-clueless-filming-season-2" data-original-url="https://www.cinemablend.com/television/2449360/westwoods-evan-rachel-wood-was-completely-clueless-filming-season-2">complicating narratives</a>, I also understand how much I truly enjoy most of what Jonathan Nolan and Lisa Joy have done with Delos' parks and the morally defunct characters roaming around inside.</p><p>I love it all. I love Maeve in Shogun World. I love Dolores' slow-burning journey. I love the Ghost Nation reveals. I love Bernard as the audience's largely clueless surrogate. Perhaps most of all, I love James Delos' maddening story, and <a href="https://www.cinemablend.com/television/2440409/westworld-co-creator-shines-light-on-williams-confusing-post-credits-sequence" data-original-url="https://www.cinemablend.com/television/2440409/westworld-co-creator-shines-light-on-williams-confusing-post-credits-sequence">William's role in it</a>. Now to nap in a decommissioned area of the park while waiting for Season 3.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="gLkTFvaEWFFqA94fQjLE5L" name="" alt="earn and van at party atlanta season 2" src="https://cdn.mos.cms.futurecdn.net/gLkTFvaEWFFqA94fQjLE5L.jpg" mos="https://cdn.mos.cms.futurecdn.net/gLkTFvaEWFFqA94fQjLE5L.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: Fx press site)</span></figcaption></figure><h2 id="6-atlanta-fx">6. Atlanta - FX</h2><p>If only <em>Atlanta</em> could be produced like the evening news, with new episodes premiering every single weekday throughout most of the year, and sometimes weekends. <em>Robbin' Season</em> wasn't quite the tightly wound left-field surprise that Season 1 was, but it dug deeper into its main characters for hilarious <a href="https://www.cinemablend.com/television/1829479/how-atlanta-season-2-was-inspired-by-tiny-toons" data-original-url="https://www.cinemablend.com/television/1829479/how-atlanta-season-2-was-inspired-by-tiny-toons">misadventures</a> that could only happen on <em>Atlanta</em>.</p><p><em>Atlanta</em> is a special blend of comedy and drama that come from the same disturbing places, making it difficult to quantify the "enjoyability" of the hauntingly melancholy "Teddy Perkins," or the random trauma of "Woods," or any of the show's more racially charged situations, really. But enjoy it I do, along with millions of others, and I'm going to petition for Khris Davis' riotously aggravating Tracy to somehow get his own spinoff season.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="3auoa9GxNYQjYBQ4U7jHF5" name="" alt="counterpart howard j.k. simmons" src="https://cdn.mos.cms.futurecdn.net/3auoa9GxNYQjYBQ4U7jHF5.jpg" mos="https://cdn.mos.cms.futurecdn.net/3auoa9GxNYQjYBQ4U7jHF5.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div><figcaption itemprop="caption description" class="pull-"><span class="credit" itemprop="copyrightHolder">(Image credit: Starz press site)</span></figcaption></figure><h2 id="5-counterpart-starz">5. Counterpart - Starz</h2><p>Having debuted both of its seasons in December, <em>Counterpart</em> slides into this list with double the power. (Naturally.) As someone who loves theory-inspiring television, I consider <em>Counterpart</em> necessary viewing for everyone everywhere, at any time. Meet and grow comfortable with J.K. Simmons' fairly meek husband Howard, and then find yourself conflicted about whether or not you like him more than J.K. Simmons' more affronting character, also named Howard. Don't worry, it's not confusing. (It's totally confusing.)</p><p><em>Counterpart</em> takes a <a href="https://www.cinemablend.com/television/2463151/why-counterpart-stuck-to-one-earth-for-its-wild-season-2-premiere-reveals" data-original-url="https://www.cinemablend.com/television/2463151/why-counterpart-stuck-to-one-earth-for-its-wild-season-2-premiere-reveals">high-minded science fiction concept</a> and, without really using any additional sci-fi tropes, anchors it to a Cold War-esque back-and-forth between two factions that both seem fueled by creating as many back-room secrets as humanly possible. It's way better than that description, obviously, as double the Olivia Williams performances would already imply.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="ykNCgLAv2t69LPwss6e29h" name="" alt="killing eve" src="https://cdn.mos.cms.futurecdn.net/ykNCgLAv2t69LPwss6e29h.jpg" mos="https://cdn.mos.cms.futurecdn.net/ykNCgLAv2t69LPwss6e29h.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="4-killing-eve-bbc-america">4. Killing Eve - BBC America</h2><p>Man, oh man. Or woman, oh woman, as it were. <em>Killing Eve</em> was perhaps the most delightfully evil surprise of 2018 TV, shaking up the "cop chasing a killer" genre with a deep exploration of the central connection between the two sides. Sandra Oh's fun and highly amusing officer Eve becomes obsessed with tracking down Jodie Comer's sadistic and emotionally fractured killer Villanelle, and it's not always easy to tell when that obsession stops being purely professional.</p><p>Creator Phoebe Waller-Bridge, who turned romantic sex comedies on their head with the amazing <em>Fleabag</em>, crafted an instant classic with <em>Killing Eve</em>. For anyone whose mind is broken over how many police procedurals are still so popular on broadcast networks, <em>Killing Eve</em> is <a href="https://www.cinemablend.com/television/2429919/sandra-ohs-killing-eve-has-broken-ratings-records" data-original-url="https://www.cinemablend.com/television/2429919/sandra-ohs-killing-eve-has-broken-ratings-records">hopefully a sign</a> of where the genre is heading.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="tXWUfA5gjkzUNwceSQJaNK" name="" alt="kim and jimmy talking better call saul season 4" src="https://cdn.mos.cms.futurecdn.net/tXWUfA5gjkzUNwceSQJaNK.jpg" mos="https://cdn.mos.cms.futurecdn.net/tXWUfA5gjkzUNwceSQJaNK.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="3-better-call-saul-amc">3. Better Call Saul - AMC</h2><p>If awards snubs were actual crimes, not even Jimmy McGill would want to defend the snubbers. Thankfully, he's got better things to do in AMC's consistently excellent <em>Better Call Saul</em>, such as making <a href="https://www.cinemablend.com/television/2459066/how-better-call-sauls-finale-turned-jimmy-into-breaking-bads-saul-goodman" data-original-url="https://www.cinemablend.com/television/2459066/how-better-call-sauls-finale-turned-jimmy-into-breaking-bads-saul-goodman">his big transition</a> into shyster extraordinaire Saul Goodman. Rarely has an entertainment prequel delivered such an equally engaging story, with its <em>Breaking Bad</em> connections serving as the delectable icing in Season 4, rather than the cake itself.</p><p>Why was Season 4 so goddamned great? Rhea Seehorn, for her sympathetic portrayal of <a href="https://www.cinemablend.com/television/2459165/how-kim-wexler-is-better-call-sauls-version-of-breaking-bads-jesse-pinkman" data-original-url="https://www.cinemablend.com/television/2459165/how-kim-wexler-is-better-call-sauls-version-of-breaking-bads-jesse-pinkman">Kim Wexler's gradually downward spiral</a>. Bob Odenkirk, for stifling Jimmy's grief over Chuck and trying one last stab at living a mostly lawful life. <a href="https://www.cinemablend.com/television/2458358/why-better-call-saul-fans-shouldnt-compare-mike-to-breaking-bads-walter-white" data-original-url="https://www.cinemablend.com/television/2458358/why-better-call-saul-fans-shouldnt-compare-mike-to-breaking-bads-walter-white">Jonathan Banks</a>, for this season-long look at what it takes for Mike to make a mistake. And then co-creators Vince Gilligan and Peter Gould, and all the writers and other actors and crew members, etc.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="tA7czSHwgFPuVn3GZGNzYo" name="" alt="" src="https://cdn.mos.cms.futurecdn.net/tA7czSHwgFPuVn3GZGNzYo.png" mos="https://cdn.mos.cms.futurecdn.net/tA7czSHwgFPuVn3GZGNzYo.png" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="2-bojack-horseman-netflix">2. BoJack Horseman - Netflix</h2><p>For the fifth season in a row, <em>BoJack Horseman</em> was arguably the most humanistic show on TV, despite most of its characters being animated anthropomorphic animals driven by their worst instincts. Its lack of live-action storytelling is largely what allows the Hollywoo-based comedy to scathingly reflect the entertainment industry's skeletons with such darkly comedic success.</p><p>Giving its titular star a new TV project and a new fling in Stephanie Beatriz's human Gina, <em>BoJack Horseman</em> dives deeper than ever into the character's substance abuse seriously affecting his personal life and career, showcasing a wowzers #MeToo-adjacent storyline that wholly avoided kid gloves. Also, speaking to my own personal catharsis, the stunning episode "Free Churros" delivered an <a href="https://www.cinemablend.com/television/2457791/bojack-horsemans-best-season-5-episode-is-another-format-breaking-masterpiece" data-original-url="https://www.cinemablend.com/television/2457791/bojack-horsemans-best-season-5-episode-is-another-format-breaking-masterpiece">episode-length funeral eulogy</a> that debuted the weekend after my mother died, and it spoke right to my churro-loving soul.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="YnNCZTcBD6hhGW3AZv2eEQ" name="" alt="" src="https://cdn.mos.cms.futurecdn.net/YnNCZTcBD6hhGW3AZv2eEQ.jpg" mos="https://cdn.mos.cms.futurecdn.net/YnNCZTcBD6hhGW3AZv2eEQ.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="1-the-haunting-of-hill-house-netflix">1. The Haunting of Hill House - Netflix</h2><p>If <em>BoJack</em>'s single funeral episode offered me a window of emotional release, then <em>The Haunting of Hill House</em>'s first season was a glass-plated skyscraper of <a href="https://www.cinemablend.com/television/2459125/4-reasons-why-netflixs-the-haunting-of-hill-house-is-tvs-best-horror" data-original-url="https://www.cinemablend.com/television/2459125/4-reasons-why-netflixs-the-haunting-of-hill-house-is-tvs-best-horror">heart-smooshing magic</a>, albeit with ghosts and terror and whatnot. Created with methodical precision by filmmaker Mike Flanagan, an all-star cast, and a detail-oriented crew, <em>The Haunting of Hill House</em> was easily the best thing that <a href="https://www.cinemablend.com/television/2462941/the-haunting-of-hill-houses-golden-globes-snub-proves-horror-still-isnt-taken-seriously" data-original-url="https://www.cinemablend.com/television/2462941/the-haunting-of-hill-houses-golden-globes-snub-proves-horror-still-isnt-taken-seriously">2018 TV could have delivered</a>.</p><p>As a <a href="https://www.cinemablend.com/television/2463483/the-10-best-horror-tv-shows-of-2018" data-original-url="https://www.cinemablend.com/television/2463483/the-10-best-horror-tv-shows-of-2018">horror series</a>, it's bursting with intelligent decisions and creep-tastic frights that work visually, audibly and psychologically. As a dysfunctional family story, <em>Hill House</em> hits all the right marks with the sibling rivalries, parental disagreements and the characters' personal hang-ups. As pure entertainment, it's a fully rounded look at grief, the limits of mortality and how the scariest places in the world are often the most familiar to us.</p><p>I could feasibly spend most of <em>The Haunting of Hill House</em>'s Season 1 running time going on and on about the show's expert balance of style and substance. Or about Mike Flanagan's standout direction. Or about the actresses portraying both generations of Crain sisters. Or about how the writers formatted the story so perfectly by reflecting on previous moments under a new light. 2019 will need a miracle to deliver anything that wows me as much as <em>Hill House</em> did.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="fqrj5J4Bg6xquZjBmJRsUU" name="" alt="" src="https://cdn.mos.cms.futurecdn.net/fqrj5J4Bg6xquZjBmJRsUU.png" mos="https://cdn.mos.cms.futurecdn.net/fqrj5J4Bg6xquZjBmJRsUU.png" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="those-that-regrettably-just-missed-the-cut">Those That Regrettably Just Missed The Cut</h2><p>The Shivering Truth - Adult Swim</p><p>Homecoming - Amazon</p><p>Barry - HBO</p><p>It's Always Sunny in Philadelphia - FXX</p><p>Santa Clarita Diet - Netflix</p><p>Titans - DC Universe</p><p>Daredevil - Netflix</p><p>Mayans M.C. - FX</p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ The Biggest TV Deaths Of 2018 ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/2464292/the-biggest-tv-deaths-of-2018</link>
                                                                            <description>
                            <![CDATA[ 2018 was a bloodbath on the small screen, and here are the biggest TV deaths of the past year. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">3TYTMU9Pj2yZpfgWAU3e69</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/Yv2WEQBGzFrVdsYMsiot45-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Mon, 31 Dec 2018 23:15:52 +0000</pubDate>                                                                                                                                <updated>Fri, 16 Sep 2022 10:59:29 +0000</updated>
                                                                                                                                            <category><![CDATA[Television]]></category>
                                                                                                                    <dc:creator><![CDATA[ Laura Hurley ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/QH79Cgm7CUgaKVxFkgHoAS.png ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Laura Hurley is a Senior Content Producer at CinemaBlend. She started at CinemaBlend as a freelancer in 2015 with a strong background in sci-fi and superheroes. She has since gone on to write full time as part of the staff, and covers a wide variety of television across the small screen and streaming. Primetime is her time of day, and she can also be found covering nighttime TV ranging from medical dramas to crime procedurals to sci-fi, and everything in between. She studied English, and is happy to have found a use for it. If it&#039;s set in the Dick Wolf TV universe, she watches it.&amp;nbsp;&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What She&#039;s Into&lt;/strong&gt;: Laura&#039;s lifetime love of fiction set her up for spending her days writing about television, and she continues to enjoy binge-watching, binge-reading, and going to the movies. Her love of underdog stories set her up for a lifetime of rooting for Cleveland sports teams, which has paid off exactly once in her lifetime. (Thanks, LeBron!) She can still quote The X-Files and will happily do so over a plate of pad thai.&amp;nbsp;&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What She&#039;s Excited About Right Now&lt;/strong&gt;: Ahsoka, Barbie pink, the day that scripted TV comes back, and the end of the Droughtlander before Outlander Season 7 returns&lt;/p&gt; ]]></dc:description>
                                                                                                                                <cf:isSponsored>false</cf:isSponsored>
                <cf:hasAffiliateLinks>false</cf:hasAffiliateLinks>
                <cf:isPaid>false</cf:isPaid>
                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/Yv2WEQBGzFrVdsYMsiot45-1280-80.jpg">
                                                            <media:credit><![CDATA[null]]></media:credit>
                                                                                                                                                                                                                                                                                                                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/Yv2WEQBGzFrVdsYMsiot45-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>Grab your tissues and prepare for a blast from the bloody TV past of 2018! This past year had its highs and lows on the small screen, and no shortage of characters bit the dust on their various shows. Some deaths happened because characters had run their course, while others went down for reasons having to do with the actor rather than the story. Some were devastating and shocking, and some were deaths that fans saw coming for a long time.</p><p>Now, as the 2019 television season gets into gear, the time is right to look back at the biggest and most impactful TV deaths of 2018! <strong>WARNING: MASSIVE SPOILERS FOR A BUNCH OF SHOWS LIE AHEAD.</strong></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="jsGGyPYFd7vR8ghqz5wKWN" name="" alt="lethal weapon riggs" src="https://cdn.mos.cms.futurecdn.net/jsGGyPYFd7vR8ghqz5wKWN.png" mos="https://cdn.mos.cms.futurecdn.net/jsGGyPYFd7vR8ghqz5wKWN.png" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="martin-riggs-lethal-weapon">Martin Riggs, Lethal Weapon</h2><p>In the case of Martin Riggs on <em>Lethal Weapon</em>, the big death happened because the show needed a way to <a href="https://www.cinemablend.com/television/2458283/how-lethal-weapons-season-3-premiere-handled-clayne-crawfords-departure" data-original-url="https://www.cinemablend.com/television/2458283/how-lethal-weapons-season-3-premiere-handled-clayne-crawfords-departure">write out actor Clayne Crawford</a> without really leaving the door open for the character return. After allegations of misconduct from Crawford on the set of <em>Lethal Weapon</em> (with some <a href="https://www.cinemablend.com/television/2429589/lethal-weapons-damon-wayans-and-clayne-crawford-clashed-on-set-and-theres-nsfw-video" data-original-url="https://www.cinemablend.com/television/2429589/lethal-weapons-damon-wayans-and-clayne-crawford-clashed-on-set-and-theres-nsfw-video">seriously NSFW audio</a> seemingly backing up those allegations), the decision was made to fire Crawford and <a href="https://www.cinemablend.com/television/2459986/the-lethal-weapon-cast-thought-the-show-was-cancelled-after-clayne-crawfords-firing" data-original-url="https://www.cinemablend.com/television/2459986/the-lethal-weapon-cast-thought-the-show-was-cancelled-after-clayne-crawfords-firing">attempt to continue</a> to show without one half of the legendary <a href="https://www.cinemablend.com/television/2460527/why-lethal-weapon-can-have-a-future-without-murtaugh-and-riggs-according-to-keesha-sharp" data-original-url="https://www.cinemablend.com/television/2460527/why-lethal-weapon-can-have-a-future-without-murtaugh-and-riggs-according-to-keesha-sharp">Riggs/Murtaugh dynamic</a>.</p><p>The Season 3 premiere revealed that Riggs had died in the Season 2 cliffhanger, and Murtaugh got a <a href="https://www.cinemablend.com/television/2460908/lethal-weapons-cole-cliffhanger-proves-the-show-definitely-doesnt-need-riggs" data-original-url="https://www.cinemablend.com/television/2460908/lethal-weapons-cole-cliffhanger-proves-the-show-definitely-doesnt-need-riggs">fun new partner</a> in the form of Seann William Scott's Cole.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="BNJXe6cNWgLwunpw9s2jcG" name="" alt="" src="https://cdn.mos.cms.futurecdn.net/BNJXe6cNWgLwunpw9s2jcG.jpg" mos="https://cdn.mos.cms.futurecdn.net/BNJXe6cNWgLwunpw9s2jcG.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="alvin-olinsky-chicago-p-d">Alvin Olinsky, Chicago P.D.</h2><p><em>Chicago P.D.</em> shocked and alarmed viewers in the penultimate episode of Season 5 when the wrongfully-imprisoned Olinsky was jumped by another inmate and <a href="https://www.cinemablend.com/television/2413872/what-chicago-pds-bloody-cliffhanger-means-for-the-season-5-finale" data-original-url="https://www.cinemablend.com/television/2413872/what-chicago-pds-bloody-cliffhanger-means-for-the-season-5-finale">stabbed repeatedly</a>. The Season 5 finale revealed that Olinsky had died from his injuries, which prompted Voight -- who was pretty much responsible for Olinsky being in the clink in the first place -- to cross <a href="https://www.cinemablend.com/television/2417462/how-chicago-pd-resolved-that-bloody-cliffhanger-and-set-the-stage-for-season-6" data-original-url="https://www.cinemablend.com/television/2417462/how-chicago-pd-resolved-that-bloody-cliffhanger-and-set-the-stage-for-season-6">a lot of lines</a> to try and avenge his friend.</p><p>As executive producer Rick Eid said, Olinsky <a href="https://www.cinemablend.com/television/2417642/why-chicago-pd-shockingly-killed-that-major-character-in-the-finale" data-original-url="https://www.cinemablend.com/television/2417642/why-chicago-pd-shockingly-killed-that-major-character-in-the-finale">didn't have to die</a>, and that made the twist all the more tragic. Only time will tell if and how Olinsky's death will continue <a href="https://www.cinemablend.com/television/2458671/how-chicago-pds-voight-is-dealing-with-olinskys-death-in-season-6" data-original-url="https://www.cinemablend.com/television/2458671/how-chicago-pds-voight-is-dealing-with-olinskys-death-in-season-6">to haunt Voight</a> moving forward.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="2DwbvKZXhdBiGWm6YBLFCh" name="" alt="" src="https://cdn.mos.cms.futurecdn.net/2DwbvKZXhdBiGWm6YBLFCh.jpg" mos="https://cdn.mos.cms.futurecdn.net/2DwbvKZXhdBiGWm6YBLFCh.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="jack-pearson-this-is-us">Jack Pearson, This Is Us</h2><p>If there was one TV tragedy of 2018 that everybody saw coming, that tragedy has to be the death of Jack Pearson on <em>This Is Us</em>. Viewers have known from the very first episode of the series that Jack had died long before the present day action, and the only question was of what happened that he passed away. Well, after lots of hints and teases, Season 2 finally revealed what happened: a <a href="https://www.cinemablend.com/television/2306452/watch-this-is-us-milo-ventimiglia-ask-for-crock-pot-forgiveness-in-super-bowl-video" data-original-url="https://www.cinemablend.com/television/2306452/watch-this-is-us-milo-ventimiglia-ask-for-crock-pot-forgiveness-in-super-bowl-video">faulty Crock-Pot</a> sparked a fire in the Pearson household.</p><p>Jack didn't actually die in the fire, and the whole family (and their dog) made it out alive. It wasn't until Jack was at the hospital that the effects of the smoke got to him, and he <a href="https://www.cinemablend.com/television/2306651/this-is-us-finally-revealed-how-jack-died" data-original-url="https://www.cinemablend.com/television/2306651/this-is-us-finally-revealed-how-jack-died">died of heart failure</a>.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="SuVEZQREEymCeQEBwriBbY" name="" alt="" src="https://cdn.mos.cms.futurecdn.net/SuVEZQREEymCeQEBwriBbY.jpg" mos="https://cdn.mos.cms.futurecdn.net/SuVEZQREEymCeQEBwriBbY.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="gabriel-supernatural">Gabriel, Supernatural</h2><p><em>Supernatural</em> is known for its habit of killing off characters and <a href="https://www.cinemablend.com/television/1660970/castiels-best-death-on-supernatural-according-to-misha-collins" data-original-url="https://www.cinemablend.com/television/1660970/castiels-best-death-on-supernatural-according-to-misha-collins">then bringing them back</a>, whether to life or as ghosts or as doppelgangers from another world. Gabriel, also known as Loki and the Trickster, was one character that seemed to die only to <a href="https://www.cinemablend.com/television/2411302/how-supernatural-filmed-that-epic-gabriel-fight-scene-according-to-richard-speight-jr" data-original-url="https://www.cinemablend.com/television/2411302/how-supernatural-filmed-that-epic-gabriel-fight-scene-according-to-richard-speight-jr">pop back up alive</a> years later in Season 13. Unfortunately, he didn't last long. Good old Gabe decided that he was done living a listless existence and joined the Winchester boys in a move that would ultimately result in his death.</p><p>Gabriel traveled to Apocalypse World with the Winchesters on their quest to rescue Jack and Mary, but the group was <a href="https://www.cinemablend.com/television/2459747/supernatural-just-delivered-a-huge-michael-twist-and-it-definitely-needs-to-change" data-original-url="https://www.cinemablend.com/television/2459747/supernatural-just-delivered-a-huge-michael-twist-and-it-definitely-needs-to-change">stopped by Michael</a> before they could escape to their own world. Although the mischievous archangel decided to face off against Michael, <a href="https://www.cinemablend.com/television/2421422/how-it-feels-to-get-killed-off-supernatural-according-to-one-actor" data-original-url="https://www.cinemablend.com/television/2421422/how-it-feels-to-get-killed-off-supernatural-according-to-one-actor">he was killed</a> in the process, and his angel wings were burned into the ground of Apocalypse World. R.I.P. Gabriel!</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="s7RixQRPUx4dNGpmHkN5u3" name="" alt="" src="https://cdn.mos.cms.futurecdn.net/s7RixQRPUx4dNGpmHkN5u3.jpg" mos="https://cdn.mos.cms.futurecdn.net/s7RixQRPUx4dNGpmHkN5u3.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="roseanne-conner-roseanne-the-conners">Roseanne Conner, Roseanne/The Conners</h2><p>2018 was a wild year for the Conner family. They returned to primetime with a <em>Roseanne</em> revival back in March, <a href="https://www.cinemablend.com/television/2464270/2018s-8-biggest-tv-reboots-and-revivals-as-ranked-by-the-ratings" data-original-url="https://www.cinemablend.com/television/2464270/2018s-8-biggest-tv-reboots-and-revivals-as-ranked-by-the-ratings">receiving massive ratings</a> and a quick renewal from ABC, with all signs pointing toward a long future back on the airwaves. That is, until leading lady Roseanne Barr fired off <a href="https://www.cinemablend.com/television/2427299/roseanne-cancelled-by-abc-after-barrs-controversial-tweet" data-original-url="https://www.cinemablend.com/television/2427299/roseanne-cancelled-by-abc-after-barrs-controversial-tweet">a controversial tweet</a> that resulted in the mega-hit comedy getting the axe. ABC found a way to bring the rest of the family back, however, with <em>The Conners</em> spinoff, and that spinoff <a href="https://www.cinemablend.com/television/2459589/the-conners-premiere-how-the-show-handled-roseannes-absence" data-original-url="https://www.cinemablend.com/television/2459589/the-conners-premiere-how-the-show-handled-roseannes-absence">killed off Roseanne</a>.</p><p>Roseanne Conner technically died between the end of <em>Roseanne</em> and the beginning of <em>The Conners</em>, and Roseanne Barr spoiled how the character <a href="https://www.cinemablend.com/television/2457732/roseanne-barr-totally-spoiled-her-characters-fate-in-the-conners-spinoff" data-original-url="https://www.cinemablend.com/television/2457732/roseanne-barr-totally-spoiled-her-characters-fate-in-the-conners-spinoff">was being killed off</a> before the spinoff even premiered. Barr revealed that her character died due to an opioid overdose. Her addiction to painkillers was set up on <em>Roseanne</em>, and <em>The Conners</em> went ahead and used it as the way to get rid of the character for good.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="Yv2WEQBGzFrVdsYMsiot45" name="" alt="" src="https://cdn.mos.cms.futurecdn.net/Yv2WEQBGzFrVdsYMsiot45.jpg" mos="https://cdn.mos.cms.futurecdn.net/Yv2WEQBGzFrVdsYMsiot45.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="carl-grimes-the-walking-dead">Carl Grimes, The Walking Dead</h2><p>If there was one TV death from the 2017-2018 TV season that <a href="https://www.cinemablend.com/television/1738639/why-that-huge-walking-dead-shocker-happened-according-to-the-star" data-original-url="https://www.cinemablend.com/television/1738639/why-that-huge-walking-dead-shocker-happened-according-to-the-star">few people saw coming</a>, that death is almost certainly Carl Grimes on <a href="https://www.cinemablend.com/tag/the-walking-dead"><em>The Walking Dead</em></a>. The character was pivotal to the show for the majority of the series, and many saw him as the future of the zombie apocalypse. Throw in the fact that his comics counterpart is still alive and actor <a href="https://www.cinemablend.com/television/1738949/the-crazy-reason-why-the-walking-deads-midseason-finale-shocker-didnt-get-spoiled-early" data-original-url="https://www.cinemablend.com/television/1738949/the-crazy-reason-why-the-walking-deads-midseason-finale-shocker-didnt-get-spoiled-early">Chandler Riggs&apos; efforts</a> to prevent the twist from being spoiled, and who could have seen Carl&apos;s death via zombie bite coming?</p><p>Carl received his bite in the Season 8 midseason finale in 2017, and it was clear to fans that he was going to die when the show returned. Unlike characters like Hershel, Carl <a href="https://www.cinemablend.com/television/2317362/how-the-walking-dead-hid-carls-bite-from-the-cast-and-crew" data-original-url="https://www.cinemablend.com/television/2317362/how-the-walking-dead-hid-carls-bite-from-the-cast-and-crew">was bitten</a> on the torso, which couldn't exactly be amputated to stop the zombie virus from spreading. Carl Grimes died in the 2018 midseason premiere, <a href="https://www.cinemablend.com/television/2315031/how-the-walking-dead-handled-carls-big-death" data-original-url="https://www.cinemablend.com/television/2315031/how-the-walking-dead-handled-carls-big-death">shooting himself</a> in the head to prevent himself from turning.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="vybwk3StAtb9pRb76i8eRn" name="" alt="" src="https://cdn.mos.cms.futurecdn.net/vybwk3StAtb9pRb76i8eRn.jpg" mos="https://cdn.mos.cms.futurecdn.net/vybwk3StAtb9pRb76i8eRn.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="teddy-westworld">Teddy, Westworld</h2><p>When <em>Westworld</em> kicked off in Season 1, Teddy was more of a cowboy-in-shining-armor for Dolores than one of the many characters with a horrifyingly dark side, and that made <a href="https://www.cinemablend.com/television/2457627/james-marsden-has-a-new-netflix-show-but-what-about-westworld" data-original-url="https://www.cinemablend.com/television/2457627/james-marsden-has-a-new-netflix-show-but-what-about-westworld">his demise</a> in Season 2 all the more tragic. While he was part of Dolores' <a href="https://www.cinemablend.com/television/2463974/tvs-11-most-wtf-moments-of-2018" data-original-url="https://www.cinemablend.com/television/2463974/tvs-11-most-wtf-moments-of-2018">Host revolution</a> against the humans, she realized that his personality wouldn't allow him to be ruthless enough to survive, so she hijacked his programming and changed him. Ah, true love.</p><p>Despite Dolores' intention that the changes would allow Teddy to survive, he wound up unable to live with the knowledge that she had changed him and he had become a monster. Still, he could not hurt his beloved Dolores, so he pulled out a revolver and shot himself in the head in front of her, devastating Dolores and undoubtedly shocking many viewers.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="r978Wty78AMQhACMs4sWzX" name="" alt="" src="https://cdn.mos.cms.futurecdn.net/r978Wty78AMQhACMs4sWzX.jpg" mos="https://cdn.mos.cms.futurecdn.net/r978Wty78AMQhACMs4sWzX.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="alison-the-affair">Alison, The Affair</h2><p><em>The Affair</em> killed off one of its four main characters before the end of Season 4, and there was as much mystery about what went down on the show as what went down <a href="https://www.cinemablend.com/television/2456789/the-affairs-ruth-wilson-hints-at-drama-behind-her-showtime-exit" data-original-url="https://www.cinemablend.com/television/2456789/the-affairs-ruth-wilson-hints-at-drama-behind-her-showtime-exit">behind the scenes</a>. Season 4 revealed that Alison was dead without actually showing her death, with the explanation being that she committed suicide by drowning herself near her home. The show suggested that there may be much more to her death than suicide, but only time will tell. As for behind-the-scenes...</p><p>Well, actress Ruth Wilson -- who wanted Alison's journey to <a href="https://www.cinemablend.com/television/2455944/how-the-affairs-ruth-wilson-actually-wanted-alison-to-leave-the-show" data-original-url="https://www.cinemablend.com/television/2455944/how-the-affairs-ruth-wilson-actually-wanted-alison-to-leave-the-show">end very differently</a> -- has said that she's not allowed to talk about why <a href="https://www.cinemablend.com/television/2455870/the-affairs-ruth-wilson-apparently-cant-talk-about-why-she-left-the-show" data-original-url="https://www.cinemablend.com/television/2455870/the-affairs-ruth-wilson-apparently-cant-talk-about-why-she-left-the-show">she wanted to leave</a> <em>The Affair</em>, although she did state that it had nothing to do with pay parity. We may never know the real reason.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="BgUgs5hFU8TwQtnVpfk6cX" name="" alt="" src="https://cdn.mos.cms.futurecdn.net/BgUgs5hFU8TwQtnVpfk6cX.png" mos="https://cdn.mos.cms.futurecdn.net/BgUgs5hFU8TwQtnVpfk6cX.png" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="fitz-agents-of-s-h-i-e-l-d">Fitz, Agents Of S.H.I.E.L.D.</h2><p><em>Agents of S.H.I.E.L.D.</em> ended its fifth season <a href="https://www.cinemablend.com/television/2418691/3-agents-of-shield-characters-that-could-definitely-die-in-the-season-5-finale" data-original-url="https://www.cinemablend.com/television/2418691/3-agents-of-shield-characters-that-could-definitely-die-in-the-season-5-finale">on a tragic note</a> with the death of poor Fitz and the looming demise of Phil Coulson. Fitz had spent a big chunk of the season on a desperate mission to travel to the future to reunite with and help the rest of the S.H.I.E.L.D. agents, including his lady love Simmons. It became clear that his dark Doctor half was still present, and he <a href="https://www.cinemablend.com/television/2392431/what-that-huge-agents-of-shield-betrayal-means-for-the-end-of-the-world" data-original-url="https://www.cinemablend.com/television/2392431/what-that-huge-agents-of-shield-betrayal-means-for-the-end-of-the-world">did the unthinkable</a> to Daisy.</p><p>Fitz did have some high notes in Season 5, as he finally married Simmons in a very sweet ceremony attended <a href="https://www.cinemablend.com/television/2385342/how-agents-of-shield-just-confirmed-a-huge-fan-theory-in-the-100th-episode" data-original-url="https://www.cinemablend.com/television/2385342/how-agents-of-shield-just-confirmed-a-huge-fan-theory-in-the-100th-episode">by their grandson</a>, although neither he nor they knew it at the time. Sadly, they were not to enjoy a happily ever after, as Fitz was pinned beneath debris after a shock wave destroyed a building in the finale, and Mack and May were <a href="https://www.cinemablend.com/television/2422221/agents-of-shields-finale-delivered-a-huge-death-but-not-how-we-expected" data-original-url="https://www.cinemablend.com/television/2422221/agents-of-shields-finale-delivered-a-huge-death-but-not-how-we-expected">unable to save him</a>. Simmons is a widow shortly after she became a wife. At least there is a plan in place to retrieve a still-living version of Fitz in Season 6!</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="vQbPEQafj4SobEZwxgDRrT" name="" alt="" src="https://cdn.mos.cms.futurecdn.net/vQbPEQafj4SobEZwxgDRrT.jpg" mos="https://cdn.mos.cms.futurecdn.net/vQbPEQafj4SobEZwxgDRrT.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="frank-underwood-house-of-cards">Frank Underwood, House Of Cards</h2><p>The end seemed nigh for <em>House of Cards</em> after star Kevin Spacey was accused of sexual misconduct, but <a href="https://www.netflix.com">Netflix</a> kept the show going for one more season with Robin Wright stepping up as the lead actor. With Claire Underwood as President of the United States, that left the question of Frank. Well, Netflix didn't even wait for the new (and final) season to premiere <a href="https://www.cinemablend.com/television/2456969/new-house-of-cards-video-reveals-francis-underwoods-fate" data-original-url="https://www.cinemablend.com/television/2456969/new-house-of-cards-video-reveals-francis-underwoods-fate">before revealing</a> that he had died. <a href="https://www.cinemablend.com/television/2457422/looks-like-house-of-cards-is-going-to-keep-fans-waiting-with-underwoods-death" data-original-url="https://www.cinemablend.com/television/2457422/looks-like-house-of-cards-is-going-to-keep-fans-waiting-with-underwoods-death">The question remained</a> of how.</p><p>Well, the series finale revealed that it was none other than Doug Stamper <a href="https://www.cinemablend.com/television/2460756/house-of-cards-star-talks-about-that-shocking-finale-death" data-original-url="https://www.cinemablend.com/television/2460756/house-of-cards-star-talks-about-that-shocking-finale-death">who killed Frank</a>, via an overdose of Frank's liver medication. The tables turned on Stamper when Claire stabbed him with a letter opener, killing him... in the Oval Office, in true <em>House of Cards</em> style. Kevin Spacey's <a href="https://www.cinemablend.com/television/2464159/kevin-spaceys-weird-frank-underwood-video-has-been-watched-by-a-ton-of-people" data-original-url="https://www.cinemablend.com/television/2464159/kevin-spaceys-weird-frank-underwood-video-has-been-watched-by-a-ton-of-people">recent bizarre video</a> in the style of Frank Underwood probably isn't going to result in a resurrection for Frank or the series.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="rArzJEHUj3MS35MpC9NFxA" name="" alt="" src="https://cdn.mos.cms.futurecdn.net/rArzJEHUj3MS35MpC9NFxA.jpg" mos="https://cdn.mos.cms.futurecdn.net/rArzJEHUj3MS35MpC9NFxA.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="hidoko-ncis-los-angeles">Hidoko, NCIS: Los Angeles</h2><p>When <em>NCIS: Los Angeles</em> introduced new characters Shay Mosley and Harley Hidoko back in Season 9, it seemed like fans were in for two characters who would be around for the long run. The <a href="https://www.cinemablend.com/television/2456997/ncis-los-angeles-showrunner-explains-why-season-9-ended-on-that-huge-cliffhanger" data-original-url="https://www.cinemablend.com/television/2456997/ncis-los-angeles-showrunner-explains-why-season-9-ended-on-that-huge-cliffhanger">Season 9 finale</a>, however, ended with the possibility that Hidoko had died in Mexico on the mission to rescue Mosley's son, although the pile of burnt bones wasn't confirmed as hers until the Season 10 premiere. Yes, Hidoko died after only one season as part of the team.</p><p>While none of the <em>NCIS</em> shows are strangers to killing off characters, Hidoko really felt like one with a lot of story left to tell. There were big questions about her past that seemed primed for exploration in Season 10 or beyond, and it was difficult to accept over hiatus that the show would really kill her off <a href="https://www.cinemablend.com/television/2456822/ncis-los-angeles-season-10-trailer-reveals-serious-injuries-and-a-deadly-mission" data-original-url="https://www.cinemablend.com/television/2456822/ncis-los-angeles-season-10-trailer-reveals-serious-injuries-and-a-deadly-mission">off-screen without ceremony</a>. Alas, Hidoko really did die.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="M6VUWdGaJR3ia9eAPBWGqX" name="" alt="" src="https://cdn.mos.cms.futurecdn.net/M6VUWdGaJR3ia9eAPBWGqX.jpg" mos="https://cdn.mos.cms.futurecdn.net/M6VUWdGaJR3ia9eAPBWGqX.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="beatrice-horseman-bojack-horseman">Beatrice Horseman, BoJack Horseman</h2><p>2018 saw the demise of none other than Beatrice Horseman on <em>BoJack Horseman</em>. BoJack's mother was a conflicting character whose scenes ranged from darkly hilarious to depressingly dark, and <a href="https://www.cinemablend.com/television/2457791/bojack-horsemans-best-season-5-episode-is-another-format-breaking-masterpiece" data-original-url="https://www.cinemablend.com/television/2457791/bojack-horsemans-best-season-5-episode-is-another-format-breaking-masterpiece">her slow demise</a> due to dementia was difficult to watch, especially as BoJack insisted that she was faking her dementia. Her death didn't come as a shock and not a whole lot of characters mourned her, but it did lead to the standout episode of Season 5, called "Free Churro."</p><p>Like <a href="https://www.cinemablend.com/television/1607780/the-big-movies-that-inspired-that-underwater-bojack-horseman-episode" data-original-url="https://www.cinemablend.com/television/1607780/the-big-movies-that-inspired-that-underwater-bojack-horseman-episode">"Fish Out of Water,"</a> "Free Churro" broke <em>BoJack</em>'s usual format as BoJack delivered a eulogy for his mother. The episode switched between flashbacks and BoJack's actual eulogy, which was angry, heartbroken, confused, and desperate as he wondered what her final clear words to him meant.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="D4ggNJvKkzj45VK7vkqWfN" name="" alt="" src="https://cdn.mos.cms.futurecdn.net/D4ggNJvKkzj45VK7vkqWfN.jpg" mos="https://cdn.mos.cms.futurecdn.net/D4ggNJvKkzj45VK7vkqWfN.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="nell-crain-the-haunting-of-hill-house">Nell Crain, The Haunting Of Hill House</h2><p><em>The Haunting of Hill House</em> on Netflix was a series that managed to intertwine heart with all the horror so that audiences would be invested in the Crain family, and the show was <a href="https://www.cinemablend.com/television/2463483/the-10-best-horror-tv-shows-of-2018" data-original-url="https://www.cinemablend.com/television/2463483/the-10-best-horror-tv-shows-of-2018">never more successful</a> in packing an emotional punch than with the fifth episode of the series, called "The Bent-Neck Lady." That episode saw the troubled Nell Crain return to Hill House, where she was confronted by visions of her family, including a sober version of her addict of a twin brother and her deceased husband.</p><p>If that didn't already have the waterworks going and viewers reaching for the tissues, Nell's interactions with the ghost of her mom were heartbreaking, as Nell thought they were simply reuniting when her mom was really orchestrating Nell's "suicide." Nell died after her mother pushed her off a staircase, hanged to death by a noose that she'd thought was a necklace.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="fR4Xk3LxpREZoET28BP8aQ" name="" alt="" src="https://cdn.mos.cms.futurecdn.net/fR4Xk3LxpREZoET28BP8aQ.jpg" mos="https://cdn.mos.cms.futurecdn.net/fR4Xk3LxpREZoET28BP8aQ.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="quentin-lance-arrow">Quentin Lance, Arrow</h2><p>The final battle against Ricardo Diaz in <em>Arrow</em> Season 6 was not without consequences for Team Arrow, and one result <a href="https://www.cinemablend.com/television/2421452/arrows-emily-bett-rickards-shared-how-hard-it-was-to-say-goodbye-to-paul-blackthorne" data-original-url="https://www.cinemablend.com/television/2421452/arrows-emily-bett-rickards-shared-how-hard-it-was-to-say-goodbye-to-paul-blackthorne">was more dire</a> than Oliver <a href="https://www.cinemablend.com/television/2459246/how-arrow-should-change-oliver-after-prison-according-to-stephen-amell" data-original-url="https://www.cinemablend.com/television/2459246/how-arrow-should-change-oliver-after-prison-according-to-stephen-amell">winding up in prison</a>. Quentin Lance was shot in an effort to save Earth-2 Laurel Lance from Diaz, and although he was successful in preventing her death, his gunshot wound proved fatal. Despite the good guys believing he would survive, something went wrong during surgery, and he passed away in the hospital shortly before Sara arrived from <em>Legends of Tomorrow</em> for a goodbye.</p><p>Quentin's death likely didn't come as a shock to <em>Arrow</em> fans who kept up with news of the show, as it had already been announced that actor Paul Blackthorne was <a href="https://www.cinemablend.com/television/2413512/arrow-is-losing-another-longtime-star-ahead-of-season-7" data-original-url="https://www.cinemablend.com/television/2413512/arrow-is-losing-another-longtime-star-ahead-of-season-7">leaving the series</a>. It was possible that <em>Arrow</em> would find a way to write him out without killing him, but many fans knew to prepare themselves for his potential death.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="vU2aNpjbLXJ77ih8Tk9UuU" name="" alt="" src="https://cdn.mos.cms.futurecdn.net/vU2aNpjbLXJ77ih8Tk9UuU.jpg" mos="https://cdn.mos.cms.futurecdn.net/vU2aNpjbLXJ77ih8Tk9UuU.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="madison-fear-the-walking-dead">Madison, Fear The Walking Dead</h2><p><em>Fear the Walking Dead</em> Season 4 was a bloodbath for the Clark family, first with the reveal <a href="https://www.cinemablend.com/television/2411942/fear-the-walking-dead-just-delivered-a-huge-death-while-hinting-strongly-at-another" data-original-url="https://www.cinemablend.com/television/2411942/fear-the-walking-dead-just-delivered-a-huge-death-while-hinting-strongly-at-another">of Nick's death</a> and then <a href="https://www.cinemablend.com/television/2433419/fear-the-walking-dead-finally-revealed-madisons-fate-in-the-midseason-finale" data-original-url="https://www.cinemablend.com/television/2433419/fear-the-walking-dead-finally-revealed-madisons-fate-in-the-midseason-finale">the ultimate reveal</a> that Madison had died, explaining why she was entirely absent from the present timeline. Of the original Clark clan, only Alicia is left standing. Although Madison died prior to the present timeline in <em>Fear</em>, her death wasn't revealed until <a href="https://www.cinemablend.com/television/2433420/how-fear-the-walking-deads-midseason-finale-ended-things-for-the-characters" data-original-url="https://www.cinemablend.com/television/2433420/how-fear-the-walking-deads-midseason-finale-ended-things-for-the-characters">the midseason finale</a>, when viewers learned that she had sacrificed herself to save her children.</p><p>Alas, Nick didn't survive in the long run, but Madison's decision to distract a zombie horde with a flare and then sacrifice herself to give Alicia and Co. time to escape did at least keep one of her kids alive. The death wasn't altogether surprising after her notable absence from the presence, although <a href="https://www.cinemablend.com/television/2433750/how-fear-the-walking-deads-kim-dickens-feels-about-madisons-big-reveal" data-original-url="https://www.cinemablend.com/television/2433750/how-fear-the-walking-deads-kim-dickens-feels-about-madisons-big-reveal">it was a shock</a> for actress Kim Dickens.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="jXjd9m879SoXFWPALR3vKU" name="" alt="" src="https://cdn.mos.cms.futurecdn.net/jXjd9m879SoXFWPALR3vKU.png" mos="https://cdn.mos.cms.futurecdn.net/jXjd9m879SoXFWPALR3vKU.png" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="klaus-and-elijah-the-originals">Klaus And Elijah, The Originals</h2><p>Well, let it not be said that <em>The Vampire Diaries</em>/<em>The Originals</em> showrunner Julie Plec is afraid to end series <a href="https://www.cinemablend.com/television/2454997/why-the-originals-finale-ended-that-way-for-klaus-and-elijah-according-to-the-creator" data-original-url="https://www.cinemablend.com/television/2454997/why-the-originals-finale-ended-that-way-for-klaus-and-elijah-according-to-the-creator">on controversial notes</a>! The series finale of <em>The Originals</em> in summer 2018 saw Klaus find some degree of redemption, and thus Elijah's goal to redeem his brother was achieved. This did not lead to either bro getting a happily-ever-after with their loved-ones, however.</p><p>Klaus was going to die, and Elijah decided that he was going to follow Klaus once more. The brothers staked each other in the final moments of the finale, dying together. For some fans, it was a fitting end for Klaus and Elijah, but some <a href="https://www.cinemablend.com/television/2455191/some-fans-were-really-upset-about-the-originals-finale" data-original-url="https://www.cinemablend.com/television/2455191/some-fans-were-really-upset-about-the-originals-finale">weren't so happy</a> that there was no reveal of where they ended up in the afterlife. Klaroline shippers <a href="https://www.cinemablend.com/television/2455068/julie-plec-explains-what-could-have-happened-to-caroline-if-the-originals-had-ended-differently" data-original-url="https://www.cinemablend.com/television/2455068/julie-plec-explains-what-could-have-happened-to-caroline-if-the-originals-had-ended-differently">weren't too pleased</a> either! At least <em>Legacies</em> delivered <a href="https://www.cinemablend.com/television/2463542/legacies-spoilers-what-happened-to-klaus-in-the-afterlife-after-the-originals" data-original-url="https://www.cinemablend.com/television/2463542/legacies-spoilers-what-happened-to-klaus-in-the-afterlife-after-the-originals">some <em>Originals</em> closure</a> for Klaus.</p><p>More TV deaths are undoubtedly on the way in 2019. For your viewing options now and in the not-too-distant future, be sure to check out our <a href="https://www.cinemablend.com/television/2461354/2019-midseason-tv-premiere-schedule-dates-for-new-and-returning-shows" data-original-url="https://www.cinemablend.com/television/2461354/2019-midseason-tv-premiere-schedule-dates-for-new-and-returning-shows">midseason TV premiere guide</a>.</p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ 9 Best Adult Animation Christmas Specials On Streaming ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/2463314/10-best-adult-animation-christmas-specials-on-streaming</link>
                                                                            <description>
                            <![CDATA[ There are a bunch of holiday specials on streaming that folks should be sure to watch. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">n1m8YUeMJeAeHDnCT6nyY2</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/TUMuD7ddtmWiAjft3WCHkG-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Tue, 11 Dec 2018 23:35:28 +0000</pubDate>                                                                                                                                                                                                                                <category><![CDATA[Television]]></category>
                                                                                                <author><![CDATA[ mick.joest@CinemaBlend.com (Mick Joest) ]]></author>                    <dc:creator><![CDATA[ Mick Joest ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/4dnBaqggYBopRBZtr5dHzg.png ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Mick Joest is a Content Producer for CinemaBlend with his hand in an eclectic mix of television goodness. Star Trek is his main jam, but he also regularly reports on happenings in the world of Star Trek, WWE, Doctor Who, 90 Day Fiancé, Quantum Leap, and Big Brother. He graduated from the University of Southern Indiana with a degree in Journalism and a minor in Radio and Television. He&#039;s great at hosting panels and appearing on podcasts if given the chance as well.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What He&#039;s Into&lt;/strong&gt;: Most everything Mick reports on because he&#039;s passionate and a fan of the subject. He really loves interviewing people and getting the bigger answers to questions. Outside of work, he&#039;s a sports fan who supports the Indiana Pacers, as well as the New England Patriots.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What He&#039;s Excited About Right Now&lt;/strong&gt;: Mick is excited for the tentative ending of the writer&#039;s strike and for more of his favorite shows like Quantum Leap and Star Trek: Strange New Worlds to finish out their in-development seasons.&amp;nbsp;&lt;/p&gt; ]]></dc:description>
                                                                                                                                <cf:isSponsored>false</cf:isSponsored>
                <cf:hasAffiliateLinks>false</cf:hasAffiliateLinks>
                <cf:isPaid>false</cf:isPaid>
                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/TUMuD7ddtmWiAjft3WCHkG-1280-80.jpg">
                                                            <media:credit><![CDATA[null]]></media:credit>
                                                                                                                                                                                                                                    <media:description><![CDATA[Futurama X Mas Story]]></media:description>                                                            <media:text><![CDATA[Futurama X Mas Story]]></media:text>
                                <media:title type="plain"><![CDATA[Futurama X Mas Story]]></media:title>
                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/TUMuD7ddtmWiAjft3WCHkG-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <p>Holiday specials are a dime a dozen on television, but there are some truly special ones available on streaming that may be lost in the rush to watch old classics and new holiday offerings. This is particularly true in the genre of adult animation, which boasts a fair amount of great holiday episodes to throw on when the old and new wear out their welcome.</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="nQievAbi8evf3qyy42YaE6" name="" alt="The Belcher Family Bob's Burgers Fox" src="https://cdn.mos.cms.futurecdn.net/nQievAbi8evf3qyy42YaE6.jpg" mos="https://cdn.mos.cms.futurecdn.net/nQievAbi8evf3qyy42YaE6.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="bob-39-s-burgers-34-bob-rest-ye-merry-gentlemen-34">Bob's Burgers- "Bob Rest Ye Merry Gentlemen"</h2><p><strong>Plot Synopsis:</strong> Bob and the family come into what they think is great wealth when a distant relative passes, and instead get a storage unit with a man believing he was a mannequin who came to life. The family takes him in for the holidays, which he repays by creating elaborate holiday window displays that draw a lot of business to the restaurant.</p><p><strong>Why you should watch it-</strong> The humor of this episode is on par with some of the best <em>Bob's Burgers</em> has to offer, but the takeaway message has that family feel to it that's perfect to remind others to be kind during the holiday season.</p><p><strong>Where to stream it</strong>- <a href="https://www.hulu.com/series/bobs-burgers-fdeb1018-4472-442f-ba94-fb087cdea069">Hulu</a></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="TUMuD7ddtmWiAjft3WCHkG" name="" alt="Futurama X Mas Story" src="https://cdn.mos.cms.futurecdn.net/TUMuD7ddtmWiAjft3WCHkG.jpg" mos="https://cdn.mos.cms.futurecdn.net/TUMuD7ddtmWiAjft3WCHkG.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="futurama-34-x-mas-story-34">Futurama- "X Mas Story"</h2><p><strong>Plot Synopsis-</strong> Fry learns about the new traditions of X-man (formerly known as Christmas) as the crew tries their best to inform him of what's changed. Unfortunately, they don't do a good enough job of warning him about Robot Santa Claus, a defective robot with unachievable standards of what qualifies as "nice." That means he strolls the streets and kills whoever he finds on his naughty list X-Mas night, which is a problem for Fry.</p><p><strong>Why You Should Watch It-</strong> <em>Futurama</em> does some pretty good gags that poke fun at the holidays, although the best moments of this episode come from Professor Farnsworth's nude romps.</p><p><strong>Where to stream it-</strong> <a href="https://www.hulu.com/series/futurama-85bf4cc1-cd8b-4469-ad87-7289217a0b74">Hulu</a></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="RziJ26G8hagXXcnw7cg9Sk" name="" alt="Bill Dautreve King of the Hill Hulu" src="https://cdn.mos.cms.futurecdn.net/RziJ26G8hagXXcnw7cg9Sk.jpg" mos="https://cdn.mos.cms.futurecdn.net/RziJ26G8hagXXcnw7cg9Sk.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="king-of-the-hill-34-livin-39-on-reds-vitamin-c-and-propane-34">King Of The Hill- "Livin' On Reds, Vitamin C, And Propane"</h2><p><strong>Plot Synopsis-</strong> Hank takes the passing of his mother's friend as an excuse to rent a big rig and take it from Arlen to Arizona on a Christmas adventure with Bobby. The adventure becomes troublesome for a multitude of reasons, and Hank is discouraged when men at a diner don't view him as an actual "trucker."</p><p><strong>Why You Should Watch It-</strong> This is probably one of the best episodes of <em>King of the Hill</em> period, mainly due to the hijinks of Dale, Boomhauer and Bill. Additionally, the episode also features voice work from country artists like Trace Adkins, Travis Tritt and George Strait.</p><p><strong>Where To Stream It-</strong><a href="https://www.hulu.com/series/king-of-the-hill-52b8dd8a-eff2-4ed2-9b8d-7c0039df1c53">Hulu</a></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="tJWCZj9hPYrhpuMMkFr43a" name="" alt="Mary and Joseph Family Guy Fox" src="https://cdn.mos.cms.futurecdn.net/tJWCZj9hPYrhpuMMkFr43a.jpg" mos="https://cdn.mos.cms.futurecdn.net/tJWCZj9hPYrhpuMMkFr43a.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="family-guy-34-jesus-mary-and-joseph-34">Family Guy- "Jesus, Mary, And Joseph!"</h2><p><strong>Plot synopsis:</strong> <em>Family Guy</em> tells the story of the <a href="https://www.cinemablend.com/television/Family-Guy-Gets-Biblical-Jesus-Mary-Joseph-Christmas-Episode-49803.html" data-original-url="https://www.cinemablend.com/television/Family-Guy-Gets-Biblical-Jesus-Mary-Joseph-Christmas-Episode-49803.html">birth of Jesus</a> in a way that only the Seth McFarlane series would dare to.</p><p><strong>Why You Should Watch It:</strong> This is definitely not one that should be watched around religious relatives who may find the multitude of jokes against Christianity sacrilegious. That said, for Monty Python fans who enjoy <em>The Life Of Brian</em>, this is certainly in the same vein, with a bit more raunch because that's what <em>Family Guy</em> does. Plus, the ending is pretty hilarious.</p><p><strong>Where To Stream It-</strong> <a href="https://www.hulu.com/series/family-guy-3c3c0f8b-7366-4d15-88ab-18050285978e">Hulu</a></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="yE2uTwzZLsJsv77KbZNhwT" name="" alt="Orel Moral Orel Adult Swim" src="https://cdn.mos.cms.futurecdn.net/yE2uTwzZLsJsv77KbZNhwT.jpg" mos="https://cdn.mos.cms.futurecdn.net/yE2uTwzZLsJsv77KbZNhwT.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="moral-orel-34-the-best-christmas-ever-34">Moral Orel- "The Best Christmas Ever"</h2><p><strong>Plot Synopsis:</strong> Orel's family Christmas goes awry, but the young boy is relatively oblivious to it and is more focused on the reverend's message that Jesus may return in the form of another. Morel then suspects that his younger brother Shapey is Christ resurrected.</p><p><strong>Why You Should Watch It</strong> - Again, this probably isn't one to watch with religious relatives in earshot, but relatively funny for those who don't mind the irreverent humor. Plus, the claymation style is reminiscent of old-school Christmas specials like <a href="https://www.cinemablend.com/television/2462158/7-disturbing-truths-we-must-accept-about-rudolph-the-red-nosed-reindeer" data-original-url="https://www.cinemablend.com/television/2462158/7-disturbing-truths-we-must-accept-about-rudolph-the-red-nosed-reindeer"><em>Rudolph The Red-Nosed Reindeer</em></a>, except even more twisted. Be warned, the humor in this special is pretty damn dark!</p><p><strong>Where To Watch It-</strong> <a href="https://www.hulu.com/series/moral-orel-16691a2c-2d25-4b46-97e5-0f0b5817a59f">Hulu</a></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="RWAkCAijPzei7pBoywNdxR" name="" alt="Bojack Horseman Bojack Horseman Christmas Special: Sabrina's Christmas Wish" src="https://cdn.mos.cms.futurecdn.net/RWAkCAijPzei7pBoywNdxR.jpg" mos="https://cdn.mos.cms.futurecdn.net/RWAkCAijPzei7pBoywNdxR.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="bojack-horseman-christmas-special-sabrina-39-s-christmas-wish">Bojack Horseman Christmas Special- Sabrina's Christmas Wish</h2><p><strong>Plot Synopsis-</strong> Todd shows up to force Bojack into watching a holiday episode of "Horsin Around."</p><p><strong>Why You Should Watch It-</strong> Using "Horsin Around" for a holiday special <a href="https://www.cinemablend.com/television/Why-BoJack-Horseman-Christmas-Special-Become-An-All-Time-Classic-69114.html" data-original-url="https://www.cinemablend.com/television/Why-BoJack-Horseman-Christmas-Special-Become-An-All-Time-Classic-69114.html">is perfect</a>, and allows the Netflix original to take lots of jabs at the cheesy '90s sitcom format. Plus, the episode itself only requires a base level of what <em>Bojack Horseman</em> is about to appreciate.</p><p><strong>Where To Stream It</strong>-<a href="https://www.netflix.com/title/80019503">Netflix</a></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="UpnJ4HL3GGAttx7xRBkG23" name="" alt="Cleveland Brown The Cleveland Show" src="https://cdn.mos.cms.futurecdn.net/UpnJ4HL3GGAttx7xRBkG23.jpg" mos="https://cdn.mos.cms.futurecdn.net/UpnJ4HL3GGAttx7xRBkG23.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="the-cleveland-show-34-die-semi-hard-34">The Cleveland Show- "Die Semi-Hard"</h2><p><strong>Plot Synopsis-</strong> Cleveland recalls the main plot of <em>Die Hard</em> in an adventure that includes the cast of <em>The Cleveland Show</em>.</p><p><strong>Why You Should Watch It-</strong> This is one for the people who love <em>Die Hard</em>, but have family members with a <a href="https://www.cinemablend.com/news/2462875/new-poll-says-die-hard-isnt-a-christmas-movie" data-original-url="https://www.cinemablend.com/news/2462875/new-poll-says-die-hard-isnt-a-christmas-movie">hard-line stance</a> that it is <a href="https://www.cinemablend.com/news/2450239/bruce-willis-settles-the-die-hard-christmas-movie-debate-once-and-for-all" data-original-url="https://www.cinemablend.com/news/2450239/bruce-willis-settles-the-die-hard-christmas-movie-debate-once-and-for-all">not a Christmas movie</a>. This version is close enough to the film that fans will enjoy it, but offbeat and different enough that family members who hate Christmas action films won't grumble all that much if it gets switched on during the holidays.</p><p><strong>Where To Stream It-</strong> <a href="https://www.hulu.com/series/the-cleveland-show-f1bf2db1-d201-4c1f-8b4b-3e8cc79a85f6">Hulu</a></p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="a8iYmyzwYqeeYoEmsnrT9i" name="" alt="Stan And The Woodland Critters South Park" src="https://cdn.mos.cms.futurecdn.net/a8iYmyzwYqeeYoEmsnrT9i.jpg" mos="https://cdn.mos.cms.futurecdn.net/a8iYmyzwYqeeYoEmsnrT9i.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="south-park-34-woodland-critter-christmas-34">South Park- "Woodland Critter Christmas"</h2><p><strong>Plot Synopsis-</strong> Stan agrees to help a bunch of talking woodland creatures during the holidays, only to inadvertently create what could be a world-ending Christmas disaster.</p><p><strong>Why You Should Watch It-</strong> This one is quite possibly the raunchiest entry on the list, and perhaps the most surprising storyline. Of course, it's not as though the twist isn't entirely unpredictable, as one has to assume a seemingly innocent scenario will always get <a href="https://www.cinemablend.com/television/2458960/south-park-creators-called-cowards-by-the-catholic-league-after-molestation-episode" data-original-url="https://www.cinemablend.com/television/2458960/south-park-creators-called-cowards-by-the-catholic-league-after-molestation-episode">turned on its head</a> on <em>South Park</em>. As with previous raunchy entries, this probably won't be the best one to play around upright relatives or young children.</p><p><strong>Where To Stream It-</strong> Hulu</p><figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="iKkY5usa5mHFmgJs93846d" name="" alt="Santa Steve American Dad Fox" src="https://cdn.mos.cms.futurecdn.net/iKkY5usa5mHFmgJs93846d.jpg" mos="https://cdn.mos.cms.futurecdn.net/iKkY5usa5mHFmgJs93846d.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><h2 id="american-dad-34-ninety-north-zero-west-34">American Dad- "Ninety North, Zero West"</h2><p><strong>Plot Synopsis-</strong> The Smith family prepares to hide from Santa this year given their past adventures, but the plot is foiled when Steve goes rogue to ride a Christmas train.</p><p><strong>Why You Should Watch It</strong>- <a href="https://www.cinemablend.com/television/How-American-Dad-Separated-Itself-From-Family-Guy-126477.html" data-original-url="https://www.cinemablend.com/television/How-American-Dad-Separated-Itself-From-Family-Guy-126477.html"><em>American Dad</em></a> has had some crazy Christmas specials in the past, and this one is a great example of just how goofy these episodes can get. It may also encourage some to go through and watch the other specials related to it, which could provide a whole night's worth of entertainment.</p><p><strong>Where To Stream It</strong>- <a href="https://www.hulu.com/series/american-dad-977c8e25-cde0-41b7-80ce-e746f2d2093f">Hulu</a></p><p>There are plenty of holiday specials to enjoy on streaming, but also a great deal of good stuff coming to cable television in the coming weeks. Keep up with the latest and greatest offerings via our <a href="https://www.cinemablend.com/television/2454665/2018-fall-tv-premiere-schedule-dates-for-new-and-returning-shows" data-original-url="https://www.cinemablend.com/television/2454665/2018-fall-tv-premiere-schedule-dates-for-new-and-returning-shows">fall</a> and <a href="https://www.cinemablend.com/television/2461354/2019-midseason-tv-premiere-schedule-dates-for-new-and-returning-shows" data-original-url="https://www.cinemablend.com/television/2461354/2019-midseason-tv-premiere-schedule-dates-for-new-and-returning-shows">midseason premiere guides</a>.</p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
                                <item>
                                                            <title><![CDATA[ BoJack Horseman's Best Season 5 Episode Is Another Format-Breaking Masterpiece ]]></title>
                                                                                                                                                                                                <link>https://www.cinemablend.com/television/2457791/bojack-horsemans-best-season-5-episode-is-another-format-breaking-masterpiece</link>
                                                                            <description>
                            <![CDATA[ Bojack Horseman normally takes one episode a season to break the format, and dig deep into its story. Season 5 is no exception, with another brilliant change of pace making an exciting dent. ]]>
                                                                                                            </description>
                                                                                                                                <guid isPermaLink="false">jPaSYJdCyv2EcsRRRmCzkC</guid>
                                                                                                <enclosure url="https://cdn.mos.cms.futurecdn.net/EX9wBkqobYrFankXUkPr3F-1280-80.jpg" type="image/jpeg" length="0"></enclosure>
                                                                        <pubDate>Tue, 18 Sep 2018 19:51:47 +0000</pubDate>                                                                                                                                <updated>Mon, 08 Oct 2018 21:19:35 +0000</updated>
                                                                                                                                            <category><![CDATA[Television]]></category>
                                                                                                                    <dc:creator><![CDATA[ Mike Reyes ]]></dc:creator>                                                                                    <dc:source><![CDATA[ https://cdn.mos.cms.futurecdn.net/fmM5xsfuCSo8rQBwh2pcX.png ]]></dc:source>
                                                                <dc:description><![CDATA[ &lt;p&gt;&lt;strong&gt;The Background&lt;/strong&gt;: Mike Reyes is the Senior Movie Contributor at CinemaBlend, though that title’s more of a guideline really. Passionate about entertainment since grade school, the movies have always held a special place in his life, which explains his current occupation. Writing in some way, shape, or form since fifth grade, Mike’s time at CinemaBlend started in 2014, when he was hired as a freelance writer. In 2019, Mr. Reyes became a full time fixture of the CB staff, a decision that the management still hotly debates to this very day, questioning whether it was “a good idea, or the best idea?” Mike graduated from Drew University with a Bachelor’s Degree in Political Science, but swore off of running for public office a long time ago. You can hear him on various podcasts, you just need to know where to look.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What He&#039;s Into&lt;/strong&gt;: This is a tough question to answer, as Mike’s kind of into a lot of things. Most prominently, he is CinemaBlend’s James Bond expert, thanks to being raised with a healthy appreciation for the storied spy series and anything espionage related. Mike has several other specialized fields that he’s been passionate about since his early years. Among those interests are breaking down the ins and outs of time travel, studying and admiring Large Scale Aggressors, Titans, Kaiju, and dinosaurs; as well as detective work. Adjacent to his entertainment interests, Mr. Reyes enjoys the worlds of high end mens fashion (eyewear included), fine alcohol and cocktails, and the comforts of a good book or video game. If you ask nicely, he might even dip back into his experience as a singer, just for fun.&lt;/p&gt;
&lt;p&gt;&lt;br&gt;&lt;/p&gt;
&lt;p&gt;&lt;strong&gt;What He&#039;s Excited About Right Now&lt;/strong&gt;: The continuing hunt for the new James Bond, any and all updates about how Adam Wingard and Dan Stevens are turning Godzilla vs. Kong 2 into a stealth sequel to The Guest, and the potential for Tron: Ares to somehow be the sequel Tron: Ascension was promised to be. Also, a good excuse to be sent on another theme park assignment, and anything Guillermo del Toro has cooking,&lt;/p&gt; ]]></dc:description>
                                                                                                                                <cf:isSponsored>false</cf:isSponsored>
                <cf:hasAffiliateLinks>false</cf:hasAffiliateLinks>
                <cf:isPaid>false</cf:isPaid>
                                                                                                                                <media:content type="image/jpeg" url="https://cdn.mos.cms.futurecdn.net/EX9wBkqobYrFankXUkPr3F-1280-80.jpg">
                                                            <media:credit><![CDATA[null]]></media:credit>
                                                                                                                                                                                                                                                                                                                                                    </media:content>
                                                    <media:thumbnail url="https://cdn.mos.cms.futurecdn.net/EX9wBkqobYrFankXUkPr3F-1280-80.jpg" />
                                                                                                                                                                    <content:encoded >
                            <![CDATA[
                            <article>
                                <figure class="van-image-figure pull-" data-bordeaux-image-check ><div class='image-full-width-wrapper'><div class='image-widthsetter' ><p class="vanilla-image-block" style="padding-top:56.25%;"><img id="suM453axHKidBW9KqdeVpk" name="" alt="Bojack Horseman looking at his mother's casket" src="https://cdn.mos.cms.futurecdn.net/suM453axHKidBW9KqdeVpk.jpg" mos="https://cdn.mos.cms.futurecdn.net/suM453axHKidBW9KqdeVpk.jpg" align="" fullscreen="" width="" height="" attribution="" endorsement="" class="pull-"></p></div></div></figure><p><strong>Warning: Spoilers for Season 5, Episode 6 of <em>Bojack Horseman</em> are in play. If you aren't current with the latest season, bookmark this story and come back later when you're ready.</strong></p><p>As funny and subversive as Netflix's <a href="https://www.cinemablend.com/television/1540619/why-bojack-horsemans-underwater-episode-was-so-tough-to-complete" data-original-url="https://www.cinemablend.com/television/1540619/why-bojack-horsemans-underwater-episode-was-so-tough-to-complete"><em>Bojack Horseman</em></a> can be, it's also a show that thrives in the drama of emotional catharsis. At least once a season, there's an episode which proves that point in spades, as the usual format is broken for a continuous narrative, with just the right amount of humor mixed in to make the journey palatable. Season 5 was no exception, as in the fine tradition of episodes such as <a href="https://www.cinemablend.com/television/1607780/the-big-movies-that-inspired-that-underwater-bojack-horseman-episode" data-original-url="https://www.cinemablend.com/television/1607780/the-big-movies-that-inspired-that-underwater-bojack-horseman-episode">"Fish Out of Water"</a> and "Time's Arrow," "Free Churro" broke the show's usual format, as well as our hearts.</p><p>The episode is essentially two monologues: a shorter, more angry diatribe / flashback to Bojack's father Butterscotch Horseman, and the longer, episode-proper material from Bojack himself. Both runs are focused on the same subject, Beatrice Horseman, who as of this episode is recently deceased. With the meat of the episode focusing on Bojack's eulogy to his mother, things start out on a lighter, funnier note as our protagonist banters with the organist. However, the episode that follows is all in one setting, with Bojack saying goodbye to his mother as only he can.</p><p>In a mix of angry, biting humor and gentler self-introspection, Bojack, and in turn Will Arnett's performance, runs the gamut as the anti-hero with his name on the marquee says goodbye to his mother and their problematic relationship. One moment he's asking for her to knock twice on her casket if he's been an abject disappointment, the next he's parsing over her last words, "I see you." On top of the fresh wounds to his psyche, Bojack also heaps on his father's previous passing, as he dissects another statement of his mother's: "My husband is dead, and everything is worse now."</p><p>Ultimately, those two simple statements are the bedrock of the "Free Churro" emotional roller coaster. Thinking back to the problems he not only had with his parents, but also looking at the problems he has in his current life because of them, <em>Bojack Horseman</em> doesn't let its protagonist escape from this confrontation through the various lives of its side characters. There's still humor mixed into the episode to help the audience not totally sink into a depressed / sad state, with a particularly effective punchline at the end revealing that Bojack opened his heart to the wrong funeral. Yet, even if it was all for naught in one respect, Bojack needed to have that confrontation with himself.</p><p>Special attention also needs to be given to Will Arnett, as his performance as Bojack shines harder than ever in this episode. While a lot of his comedic and dramatic chops are on display at a regular interval, seeing it in an unflinching, consistent light is something that draws more attention to Arnett's underrated skills as a performer. His full range is on display in "Free Churro," and if anything, once <a href="https://www.cinemablend.com/television/1838509/bojack-horseman-may-soon-be-available-to-watch-outside-of-netflix" data-original-url="https://www.cinemablend.com/television/1838509/bojack-horseman-may-soon-be-available-to-watch-outside-of-netflix"><em>Bojack Horseman</em></a> wraps up, it should be remembered as one of his lynchpin roles - even above his previous turn as Gob Bluth in <a href="https://www.cinemablend.com/television/2416361/arrested-development-newly-recut-season-4-has-caused-problems-with-the-cast" data-original-url="https://www.cinemablend.com/television/2416361/arrested-development-newly-recut-season-4-has-caused-problems-with-the-cast"><em>Arrested Development</em></a>.</p><p>Placing "Free Churro" at the center of this most recent season of <em>Bojack Horseman</em> is an ingenious piece of timing, as creator and writer <a href="https://www.cinemablend.com/television/2383602/bojack-horseman-creator-has-a-new-show-coming-but-not-for-netflix" data-original-url="https://www.cinemablend.com/television/2383602/bojack-horseman-creator-has-a-new-show-coming-but-not-for-netflix">Raphael Bob Waksberg</a> anchors this episode at a point where, much like the character, it looks back at past events while also building the bridge to the rest of the season's happenings. Most importantly, for a series that consistently slides between happiness, misery, and everything in-between, this installment proves that <em>Bojack Horseman</em> continues to explore all of those feelings as freshly as it did in its first season.</p><p>The thread of Bojack and Beatrice's relationship is one that has been vital to <em>Bojack Horseman's</em> basic makeup, and with the closure of that thread, one has to wonder if the end of the show is starting to loom in sight. After all, even Bojack himself noted that with both parents dead, he's pretty much the next in line.</p><p>Bojack Horseman season 5 is currently on <a href="http://www.netflix.com">Netflix</a>, and it's well worth a revisit to catch all the details you missed the first time.</p>
                                                            </article>
                            ]]>
                        </content:encoded>
                                                </item>
            </channel>
</rss>